Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 16624..17267 Replicon plasmid unnamed1
Accession NZ_CP118399
Organism Klebsiella pneumoniae strain 2020CK-00223

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag PWK27_RS26395 Protein ID WP_001044770.1
Coordinates 16851..17267 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag PWK27_RS26390 Protein ID WP_001261282.1
Coordinates 16624..16854 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWK27_RS26355 (PWK27_26355) 12746..13381 + 636 WP_009309912.1 type II CAAX endopeptidase family protein -
PWK27_RS26360 (PWK27_26360) 13489..13830 - 342 WP_071844672.1 hypothetical protein -
PWK27_RS26365 (PWK27_26365) 14153..14683 + 531 WP_223174905.1 hypothetical protein -
PWK27_RS26370 (PWK27_26370) 14652..15089 + 438 WP_009309910.1 hypothetical protein -
PWK27_RS26375 (PWK27_26375) 15280..15720 - 441 WP_047057603.1 hypothetical protein -
PWK27_RS26380 (PWK27_26380) 15739..16362 - 624 WP_223345396.1 hypothetical protein -
PWK27_RS26385 (PWK27_26385) 16431..16667 - 237 Protein_20 hypothetical protein -
PWK27_RS26390 (PWK27_26390) 16624..16854 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PWK27_RS26395 (PWK27_26395) 16851..17267 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
PWK27_RS26400 (PWK27_26400) 17341..18903 + 1563 WP_009309907.1 AAA family ATPase -
PWK27_RS26405 (PWK27_26405) 18888..19910 + 1023 WP_000361404.1 helicase UvrD -
PWK27_RS26410 (PWK27_26410) 20455..21363 + 909 WP_032451458.1 HNH endonuclease -
PWK27_RS26415 (PWK27_26415) 21549..21899 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..136334 136334
- flank IS/Tn - - 21980..22948 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T273108 WP_001044770.1 NZ_CP118399:16851-17267 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT273108 WP_001261282.1 NZ_CP118399:16624-16854 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References