Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 6025..6550 Replicon plasmid unnamed1
Accession NZ_CP118399
Organism Klebsiella pneumoniae strain 2020CK-00223

Toxin (Protein)


Gene name ccdB Uniprot ID A0A7H9GHC5
Locus tag PWK27_RS26320 Protein ID WP_009309918.1
Coordinates 6025..6330 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A1D8K3R4
Locus tag PWK27_RS26325 Protein ID WP_006788213.1
Coordinates 6332..6550 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWK27_RS26290 (PWK27_26290) 1822..2802 - 981 WP_014386491.1 IS5-like element ISKpn26 family transposase -
PWK27_RS26295 (PWK27_26295) 2929..3186 + 258 WP_009310077.1 hypothetical protein -
PWK27_RS26300 (PWK27_26300) 3244..4023 - 780 WP_023287113.1 site-specific integrase -
PWK27_RS26305 (PWK27_26305) 4221..5237 - 1017 WP_009309921.1 hypothetical protein -
PWK27_RS26310 (PWK27_26310) 5271..5606 - 336 WP_009309920.1 hypothetical protein -
PWK27_RS26315 (PWK27_26315) 5656..5796 - 141 WP_162898808.1 hypothetical protein -
PWK27_RS26320 (PWK27_26320) 6025..6330 - 306 WP_009309918.1 type II toxin-antitoxin system toxin CcdB Toxin
PWK27_RS26325 (PWK27_26325) 6332..6550 - 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PWK27_RS26330 (PWK27_26330) 7147..7377 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin -
PWK27_RS26335 (PWK27_26335) 7374..7790 + 417 WP_009309917.1 type II toxin-antitoxin system VapC family toxin -
PWK27_RS26340 (PWK27_26340) 7831..8709 - 879 WP_009309916.1 restriction endonuclease -
PWK27_RS26345 (PWK27_26345) 9371..10648 + 1278 WP_009309915.1 HlyD family secretion protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..136334 136334
- flank IS/Tn - - 1822..2802 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11571.24 Da        Isoelectric Point: 6.4661

>T273106 WP_009309918.1 NZ_CP118399:c6330-6025 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVVPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7405

>AT273106 WP_006788213.1 NZ_CP118399:c6550-6332 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISGLVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H9GHC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1D8K3R4

References