Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4739692..4740208 | Replicon | chromosome |
Accession | NZ_CP118398 | ||
Organism | Klebsiella pneumoniae strain 2020CK-00223 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A085DK79 |
Locus tag | PWK27_RS23475 | Protein ID | WP_009309309.1 |
Coordinates | 4739692..4739976 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | PWK27_RS23480 | Protein ID | WP_002886901.1 |
Coordinates | 4739966..4740208 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWK27_RS23450 (PWK27_23450) | 4735175..4735438 | - | 264 | WP_025368518.1 | PTS sugar transporter subunit IIB | - |
PWK27_RS23455 (PWK27_23455) | 4735568..4735741 | + | 174 | WP_002886906.1 | hypothetical protein | - |
PWK27_RS23460 (PWK27_23460) | 4735744..4736487 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
PWK27_RS23465 (PWK27_23465) | 4736844..4738982 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PWK27_RS23470 (PWK27_23470) | 4739224..4739688 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PWK27_RS23475 (PWK27_23475) | 4739692..4739976 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWK27_RS23480 (PWK27_23480) | 4739966..4740208 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PWK27_RS23485 (PWK27_23485) | 4740286..4742196 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
PWK27_RS23490 (PWK27_23490) | 4742219..4743373 | - | 1155 | WP_021313684.1 | lactonase family protein | - |
PWK27_RS23495 (PWK27_23495) | 4743440..4744180 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T273103 WP_009309309.1 NZ_CP118398:c4739976-4739692 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085DK79 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |