Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4627540..4628350 | Replicon | chromosome |
Accession | NZ_CP118398 | ||
Organism | Klebsiella pneumoniae strain 2020CK-00223 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A483R2P9 |
Locus tag | PWK27_RS22990 | Protein ID | WP_048977643.1 |
Coordinates | 4627540..4628073 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | PWK27_RS22995 | Protein ID | WP_002887278.1 |
Coordinates | 4628084..4628350 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWK27_RS22985 (PWK27_22985) | 4626371..4627492 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
PWK27_RS22990 (PWK27_22990) | 4627540..4628073 | - | 534 | WP_048977643.1 | type II toxin-antitoxin system toxin KacT | Toxin |
PWK27_RS22995 (PWK27_22995) | 4628084..4628350 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
PWK27_RS23000 (PWK27_23000) | 4628453..4629886 | - | 1434 | WP_087759796.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
PWK27_RS23005 (PWK27_23005) | 4629876..4630559 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
PWK27_RS23010 (PWK27_23010) | 4630731..4632116 | + | 1386 | WP_085803494.1 | efflux transporter outer membrane subunit | - |
PWK27_RS23015 (PWK27_23015) | 4632134..4632478 | + | 345 | WP_021462623.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19842.69 Da Isoelectric Point: 5.2614
>T273102 WP_048977643.1 NZ_CP118398:c4628073-4627540 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGYDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLLSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGYDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLLSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483R2P9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |