Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4003340..4003959 Replicon chromosome
Accession NZ_CP118398
Organism Klebsiella pneumoniae strain 2020CK-00223

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PWK27_RS19965 Protein ID WP_002892050.1
Coordinates 4003741..4003959 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PWK27_RS19960 Protein ID WP_002892066.1
Coordinates 4003340..4003714 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWK27_RS19950 (PWK27_19950) 3998492..3999685 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PWK27_RS19955 (PWK27_19955) 3999708..4002854 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PWK27_RS19960 (PWK27_19960) 4003340..4003714 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PWK27_RS19965 (PWK27_19965) 4003741..4003959 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PWK27_RS19970 (PWK27_19970) 4004122..4004688 + 567 WP_002892030.1 maltose O-acetyltransferase -
PWK27_RS19975 (PWK27_19975) 4004660..4004800 - 141 WP_004147370.1 hypothetical protein -
PWK27_RS19980 (PWK27_19980) 4004821..4005291 + 471 WP_104159009.1 YlaC family protein -
PWK27_RS19985 (PWK27_19985) 4005266..4006717 - 1452 WP_104159008.1 PLP-dependent aminotransferase family protein -
PWK27_RS19990 (PWK27_19990) 4006818..4007516 + 699 WP_094310543.1 GNAT family protein -
PWK27_RS19995 (PWK27_19995) 4007513..4007653 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PWK27_RS20000 (PWK27_20000) 4007653..4007916 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T273101 WP_002892050.1 NZ_CP118398:4003741-4003959 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT273101 WP_002892066.1 NZ_CP118398:4003340-4003714 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References