Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4003340..4003959 | Replicon | chromosome |
| Accession | NZ_CP118398 | ||
| Organism | Klebsiella pneumoniae strain 2020CK-00223 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | PWK27_RS19965 | Protein ID | WP_002892050.1 |
| Coordinates | 4003741..4003959 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | PWK27_RS19960 | Protein ID | WP_002892066.1 |
| Coordinates | 4003340..4003714 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWK27_RS19950 (PWK27_19950) | 3998492..3999685 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PWK27_RS19955 (PWK27_19955) | 3999708..4002854 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PWK27_RS19960 (PWK27_19960) | 4003340..4003714 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| PWK27_RS19965 (PWK27_19965) | 4003741..4003959 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| PWK27_RS19970 (PWK27_19970) | 4004122..4004688 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| PWK27_RS19975 (PWK27_19975) | 4004660..4004800 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| PWK27_RS19980 (PWK27_19980) | 4004821..4005291 | + | 471 | WP_104159009.1 | YlaC family protein | - |
| PWK27_RS19985 (PWK27_19985) | 4005266..4006717 | - | 1452 | WP_104159008.1 | PLP-dependent aminotransferase family protein | - |
| PWK27_RS19990 (PWK27_19990) | 4006818..4007516 | + | 699 | WP_094310543.1 | GNAT family protein | - |
| PWK27_RS19995 (PWK27_19995) | 4007513..4007653 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| PWK27_RS20000 (PWK27_20000) | 4007653..4007916 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273101 WP_002892050.1 NZ_CP118398:4003741-4003959 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT273101 WP_002892066.1 NZ_CP118398:4003340-4003714 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |