Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 211408..212147 | Replicon | chromosome |
| Accession | NZ_CP118398 | ||
| Organism | Klebsiella pneumoniae strain 2020CK-00223 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | PWK27_RS01050 | Protein ID | WP_040226741.1 |
| Coordinates | 211662..212147 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | PWK27_RS01045 | Protein ID | WP_003026799.1 |
| Coordinates | 211408..211674 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWK27_RS01035 (PWK27_01035) | 208614..209938 | + | 1325 | WP_274759508.1 | IS3 family transposase | - |
| PWK27_RS01040 (PWK27_01040) | 209999..211146 | + | 1148 | WP_232553700.1 | IS3 family transposase | - |
| PWK27_RS01045 (PWK27_01045) | 211408..211674 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| PWK27_RS01050 (PWK27_01050) | 211662..212147 | + | 486 | WP_040226741.1 | GNAT family N-acetyltransferase | Toxin |
| PWK27_RS01055 (PWK27_01055) | 212472..213518 | - | 1047 | WP_004173931.1 | IS481-like element ISKpn28 family transposase | - |
| PWK27_RS01060 (PWK27_01060) | 213592..213744 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| PWK27_RS01065 (PWK27_01065) | 213823..214935 | + | 1113 | WP_001300563.1 | IS4-like element IS421 family transposase | - |
| PWK27_RS01070 (PWK27_01070) | 215395..217013 | + | 1619 | Protein_212 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 209351..215098 | 5747 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17624.44 Da Isoelectric Point: 10.3370
>T273091 WP_040226741.1 NZ_CP118398:211662-212147 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
LDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
LDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|