Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
| Location | 3245439..3246238 | Replicon | chromosome |
| Accession | NZ_CP118390 | ||
| Organism | Edwardsiella piscicida strain Ep21-8 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | PWJ79_RS14775 | Protein ID | WP_041692550.1 |
| Coordinates | 3245705..3246238 (+) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | PWJ79_RS14770 | Protein ID | WP_041692549.1 |
| Coordinates | 3245439..3245708 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWJ79_RS14735 (PWJ79_14735) | 3241018..3241734 | + | 717 | WP_012849890.1 | SprT family zinc-dependent metalloprotease | - |
| PWJ79_RS14740 (PWJ79_14740) | 3241979..3242518 | + | 540 | WP_012849891.1 | transposase DNA-binding-containing protein | - |
| PWJ79_RS14745 (PWJ79_14745) | 3242532..3243329 | + | 798 | Protein_2848 | IS21 family transposase | - |
| PWJ79_RS14750 (PWJ79_14750) | 3243566..3243781 | - | 216 | WP_012849893.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
| PWJ79_RS14755 (PWJ79_14755) | 3243793..3244056 | - | 264 | WP_041692548.1 | DUF2442 domain-containing protein | - |
| PWJ79_RS14760 (PWJ79_14760) | 3244016..3244255 | - | 240 | WP_012849894.1 | DUF4160 domain-containing protein | - |
| PWJ79_RS14765 (PWJ79_14765) | 3244749..3245345 | + | 597 | WP_071818540.1 | helix-turn-helix domain-containing protein | - |
| PWJ79_RS14770 (PWJ79_14770) | 3245439..3245708 | + | 270 | WP_041692549.1 | DUF1778 domain-containing protein | Antitoxin |
| PWJ79_RS14775 (PWJ79_14775) | 3245705..3246238 | + | 534 | WP_041692550.1 | GNAT family N-acetyltransferase | Toxin |
| PWJ79_RS14780 (PWJ79_14780) | 3246336..3247079 | - | 744 | WP_012849897.1 | hypothetical protein | - |
| PWJ79_RS14785 (PWJ79_14785) | 3249077..3249328 | + | 252 | Protein_2856 | IS21 family transposase | - |
| PWJ79_RS14790 (PWJ79_14790) | 3249325..3250107 | + | 783 | WP_012846920.1 | IS21-like element ISSen3 family helper ATPase IstB | - |
| PWJ79_RS14795 (PWJ79_14795) | 3250212..3251015 | + | 804 | WP_012849899.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3203579..3259228 | 55649 | |
| - | flank | IS/Tn | - | - | 3242532..3243413 | 881 | |
| - | flank | IS/Tn | - | - | 3249328..3250107 | 779 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19938.93 Da Isoelectric Point: 7.0275
>T273090 WP_041692550.1 NZ_CP118390:3245705-3246238 [Edwardsiella piscicida]
MNSGTEFKELSKADHDRDSFDCGEIELNNFIKNFALKHMRVGISKTMVLPATDALPNNKHPICAFYTVAPSSITRNSLPD
DLGKKLPHYPVPVFLLAQLSVHIDNQGDGLGKITLIKALEYLWNVNYFLHAYAVVVDCLNDKAESFYRKYGFETLCSYDG
RVRLFLPMKTVAGLFSD
MNSGTEFKELSKADHDRDSFDCGEIELNNFIKNFALKHMRVGISKTMVLPATDALPNNKHPICAFYTVAPSSITRNSLPD
DLGKKLPHYPVPVFLLAQLSVHIDNQGDGLGKITLIKALEYLWNVNYFLHAYAVVVDCLNDKAESFYRKYGFETLCSYDG
RVRLFLPMKTVAGLFSD
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|