Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 68928..69454 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP118384 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00224 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7R6HXL1 |
| Locus tag | PWH45_RS23975 | Protein ID | WP_015572079.1 |
| Coordinates | 69167..69454 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | PWH45_RS23970 | Protein ID | WP_000534858.1 |
| Coordinates | 68928..69167 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWH45_RS23940 (PWH45_23940) | 64001..64936 | - | 936 | WP_004118100.1 | GlxA family transcriptional regulator | - |
| PWH45_RS23945 (PWH45_23945) | 64947..66149 | - | 1203 | WP_015572077.1 | MFS transporter | - |
| PWH45_RS23950 (PWH45_23950) | 66189..66950 | - | 762 | WP_004118132.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PWH45_RS23955 (PWH45_23955) | 66980..67795 | - | 816 | WP_032670836.1 | SDR family oxidoreductase | - |
| PWH45_RS23960 (PWH45_23960) | 68259..68579 | + | 321 | WP_004197483.1 | hypothetical protein | - |
| PWH45_RS23965 (PWH45_23965) | 68801..68903 | - | 103 | Protein_75 | hypothetical protein | - |
| PWH45_RS23970 (PWH45_23970) | 68928..69167 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| PWH45_RS23975 (PWH45_23975) | 69167..69454 | + | 288 | WP_015572079.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PWH45_RS23980 (PWH45_23980) | 69526..69684 | + | 159 | WP_013087178.1 | type I toxin-antitoxin system Hok family toxin | - |
| PWH45_RS23985 (PWH45_23985) | 70408..70926 | + | 519 | WP_274753234.1 | hypothetical protein | - |
| PWH45_RS23990 (PWH45_23990) | 70923..71270 | + | 348 | WP_045325353.1 | hypothetical protein | - |
| PWH45_RS23995 (PWH45_23995) | 71972..72265 | + | 294 | WP_032670838.1 | hypothetical protein | - |
| PWH45_RS24000 (PWH45_24000) | 72282..73103 | + | 822 | WP_015572081.1 | DUF932 domain-containing protein | - |
| PWH45_RS24005 (PWH45_24005) | 73132..73671 | - | 540 | WP_032664846.1 | lytic transglycosylase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..175563 | 175563 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11209.09 Da Isoelectric Point: 10.0714
>T273081 WP_015572079.1 NZ_CP118384:69167-69454 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKNKLAEVLESPRIDANKLRGMHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKNKLAEVLESPRIDANKLRGMHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4FXE | |
| PDB | 2KC8 | |
| PDB | 2K29 | |
| AlphaFold DB | A0A4V1CTS8 |