Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4704962..4705569 | Replicon | chromosome |
| Accession | NZ_CP118383 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00224 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2J0PXG2 |
| Locus tag | PWH45_RS22625 | Protein ID | WP_071788668.1 |
| Coordinates | 4705384..4705569 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PWH45_RS22620 | Protein ID | WP_047745930.1 |
| Coordinates | 4704962..4705369 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWH45_RS22590 (PWH45_22590) | 4700803..4701456 | + | 654 | WP_017693795.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| PWH45_RS22595 (PWH45_22595) | 4701459..4702319 | + | 861 | WP_017693794.1 | L-ribulose-5-phosphate 3-epimerase | - |
| PWH45_RS22600 (PWH45_22600) | 4702313..4703008 | + | 696 | WP_015572759.1 | L-ribulose-5-phosphate 4-epimerase | - |
| PWH45_RS22605 (PWH45_22605) | 4703009..4703296 | - | 288 | Protein_4416 | helix-turn-helix domain-containing protein | - |
| PWH45_RS22610 (PWH45_22610) | 4703291..4703680 | + | 390 | Protein_4417 | glycoside hydrolase family 127 protein | - |
| PWH45_RS22615 (PWH45_22615) | 4703882..4704958 | + | 1077 | WP_047354172.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| PWH45_RS22620 (PWH45_22620) | 4704962..4705369 | - | 408 | WP_047745930.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PWH45_RS22625 (PWH45_22625) | 4705384..4705569 | - | 186 | WP_071788668.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PWH45_RS22630 (PWH45_22630) | 4705819..4707357 | - | 1539 | WP_047745931.1 | aldehyde dehydrogenase AldB | - |
| PWH45_RS22635 (PWH45_22635) | 4707524..4708408 | + | 885 | WP_047745933.1 | ROK family protein | - |
| PWH45_RS22640 (PWH45_22640) | 4708412..4710250 | - | 1839 | WP_047745934.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6822.05 Da Isoelectric Point: 11.5191
>T273079 WP_071788668.1 NZ_CP118383:c4705569-4705384 [Enterobacter hormaechei]
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15076.88 Da Isoelectric Point: 4.3197
>AT273079 WP_047745930.1 NZ_CP118383:c4705369-4704962 [Enterobacter hormaechei]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHLEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPR
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHLEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPR
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|