Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3725490..3726066 | Replicon | chromosome |
| Accession | NZ_CP118383 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00224 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A800YKM1 |
| Locus tag | PWH45_RS17780 | Protein ID | WP_015572580.1 |
| Coordinates | 3725779..3726066 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A801DSF4 |
| Locus tag | PWH45_RS17775 | Protein ID | WP_017694570.1 |
| Coordinates | 3725490..3725792 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWH45_RS17755 (PWH45_17755) | 3721787..3722332 | + | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
| PWH45_RS17760 (PWH45_17760) | 3722508..3723878 | - | 1371 | WP_047745287.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| PWH45_RS17765 (PWH45_17765) | 3724032..3724784 | + | 753 | WP_047745285.1 | AraC family transcriptional regulator | - |
| PWH45_RS17770 (PWH45_17770) | 3724823..3725461 | + | 639 | WP_047736941.1 | LysE family translocator | - |
| PWH45_RS17775 (PWH45_17775) | 3725490..3725792 | - | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
| PWH45_RS17780 (PWH45_17780) | 3725779..3726066 | - | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
| PWH45_RS17785 (PWH45_17785) | 3726236..3727507 | + | 1272 | WP_047745284.1 | DUF445 domain-containing protein | - |
| PWH45_RS17790 (PWH45_17790) | 3727504..3728580 | - | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
| PWH45_RS17795 (PWH45_17795) | 3728570..3729637 | - | 1068 | WP_116293634.1 | HlyD family secretion protein | - |
| PWH45_RS17800 (PWH45_17800) | 3729634..3730104 | - | 471 | WP_015572576.1 | MarR family transcriptional regulator | - |
| PWH45_RS17805 (PWH45_17805) | 3730254..3730949 | - | 696 | WP_032647138.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T273077 WP_015572580.1 NZ_CP118383:c3726066-3725779 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|