Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3301525..3302182 | Replicon | chromosome |
| Accession | NZ_CP118383 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00224 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | PWH45_RS15740 | Protein ID | WP_274751622.1 |
| Coordinates | 3301525..3301935 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | PWH45_RS15745 | Protein ID | WP_003863437.1 |
| Coordinates | 3301916..3302182 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWH45_RS15720 (PWH45_15720) | 3297523..3299256 | - | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PWH45_RS15725 (PWH45_15725) | 3299262..3299975 | - | 714 | WP_047745230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PWH45_RS15730 (PWH45_15730) | 3300004..3300900 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| PWH45_RS15735 (PWH45_15735) | 3301002..3301523 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| PWH45_RS15740 (PWH45_15740) | 3301525..3301935 | - | 411 | WP_274751622.1 | protein YgfX | Toxin |
| PWH45_RS15745 (PWH45_15745) | 3301916..3302182 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| PWH45_RS15750 (PWH45_15750) | 3302477..3303457 | + | 981 | WP_017382888.1 | tRNA-modifying protein YgfZ | - |
| PWH45_RS15755 (PWH45_15755) | 3303569..3304228 | - | 660 | WP_047745228.1 | hemolysin III family protein | - |
| PWH45_RS15760 (PWH45_15760) | 3304495..3305226 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| PWH45_RS15765 (PWH45_15765) | 3305343..3306776 | + | 1434 | WP_047745227.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16335.23 Da Isoelectric Point: 11.4775
>T273076 WP_274751622.1 NZ_CP118383:c3301935-3301525 [Enterobacter hormaechei]
VVLWQSDLRLSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRLSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|