Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4562458..4563161 Replicon chromosome
Accession NZ_CP118332
Organism Klebsiella aerogenes strain IIIF7SW-P1

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag HZS33_RS21835 Protein ID WP_040196446.1
Coordinates 4562458..4562799 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag HZS33_RS21840 Protein ID WP_040196448.1
Coordinates 4562820..4563161 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HZS33_RS21805 (4557815) 4557815..4558141 + 327 WP_047075942.1 hypothetical protein -
HZS33_RS21810 (4558179) 4558179..4558814 - 636 WP_045394770.1 HNH endonuclease -
HZS33_RS21815 (4558994) 4558994..4559863 + 870 WP_047075943.1 HNH endonuclease -
HZS33_RS21820 (4559904) 4559904..4560245 - 342 WP_047075944.1 hypothetical protein -
HZS33_RS21825 (4560242) 4560242..4560802 - 561 WP_171829914.1 type IV secretion protein Rhs -
HZS33_RS21830 (4561192) 4561192..4562199 - 1008 WP_044864458.1 restriction endonuclease -
HZS33_RS21835 (4562458) 4562458..4562799 - 342 WP_040196446.1 TA system toxin CbtA family protein Toxin
HZS33_RS21840 (4562820) 4562820..4563161 - 342 WP_040196448.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
HZS33_RS21845 (4563172) 4563172..4563714 - 543 WP_004894621.1 DNA repair protein RadC -
HZS33_RS21850 (4563727) 4563727..4564170 - 444 WP_179373398.1 antirestriction protein -
HZS33_RS21855 (4564201) 4564201..4565022 - 822 WP_112777523.1 DUF932 domain-containing protein -
HZS33_RS21860 (4565121) 4565121..4565351 - 231 WP_112777522.1 DUF905 domain-containing protein -
HZS33_RS21865 (4565423) 4565423..4565872 - 450 WP_014226752.1 IrmA family protein -
HZS33_RS21870 (4565869) 4565869..4566321 - 453 WP_112777521.1 hypothetical protein -
HZS33_RS21875 (4566358) 4566358..4566927 - 570 WP_102014662.1 hypothetical protein -
HZS33_RS21880 (4566927) 4566927..4567631 - 705 WP_049190322.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4556977..4589032 32055


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-109)

Antitoxin

Antitoxin CbeA

(13-112)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12791.74 Da        Isoelectric Point: 7.1648

>T273070 WP_040196446.1 NZ_CP118332:c4562799-4562458 [Klebsiella aerogenes]
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ

Download         Length: 342 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12829.33 Da        Isoelectric Point: 5.4792

>AT273070 WP_040196448.1 NZ_CP118332:c4563161-4562820 [Klebsiella aerogenes]
MKSTDSENDSFLQWGLNRNVTPCFGARLVQEGNRLHYLVDRASITGDFSNAESLKLDEVFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSYGYVYIAIYPTQR

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References