Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4562458..4563161 | Replicon | chromosome |
| Accession | NZ_CP118332 | ||
| Organism | Klebsiella aerogenes strain IIIF7SW-P1 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | HZS33_RS21835 | Protein ID | WP_040196446.1 |
| Coordinates | 4562458..4562799 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | HZS33_RS21840 | Protein ID | WP_040196448.1 |
| Coordinates | 4562820..4563161 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZS33_RS21805 (4557815) | 4557815..4558141 | + | 327 | WP_047075942.1 | hypothetical protein | - |
| HZS33_RS21810 (4558179) | 4558179..4558814 | - | 636 | WP_045394770.1 | HNH endonuclease | - |
| HZS33_RS21815 (4558994) | 4558994..4559863 | + | 870 | WP_047075943.1 | HNH endonuclease | - |
| HZS33_RS21820 (4559904) | 4559904..4560245 | - | 342 | WP_047075944.1 | hypothetical protein | - |
| HZS33_RS21825 (4560242) | 4560242..4560802 | - | 561 | WP_171829914.1 | type IV secretion protein Rhs | - |
| HZS33_RS21830 (4561192) | 4561192..4562199 | - | 1008 | WP_044864458.1 | restriction endonuclease | - |
| HZS33_RS21835 (4562458) | 4562458..4562799 | - | 342 | WP_040196446.1 | TA system toxin CbtA family protein | Toxin |
| HZS33_RS21840 (4562820) | 4562820..4563161 | - | 342 | WP_040196448.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| HZS33_RS21845 (4563172) | 4563172..4563714 | - | 543 | WP_004894621.1 | DNA repair protein RadC | - |
| HZS33_RS21850 (4563727) | 4563727..4564170 | - | 444 | WP_179373398.1 | antirestriction protein | - |
| HZS33_RS21855 (4564201) | 4564201..4565022 | - | 822 | WP_112777523.1 | DUF932 domain-containing protein | - |
| HZS33_RS21860 (4565121) | 4565121..4565351 | - | 231 | WP_112777522.1 | DUF905 domain-containing protein | - |
| HZS33_RS21865 (4565423) | 4565423..4565872 | - | 450 | WP_014226752.1 | IrmA family protein | - |
| HZS33_RS21870 (4565869) | 4565869..4566321 | - | 453 | WP_112777521.1 | hypothetical protein | - |
| HZS33_RS21875 (4566358) | 4566358..4566927 | - | 570 | WP_102014662.1 | hypothetical protein | - |
| HZS33_RS21880 (4566927) | 4566927..4567631 | - | 705 | WP_049190322.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4556977..4589032 | 32055 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12791.74 Da Isoelectric Point: 7.1648
>T273070 WP_040196446.1 NZ_CP118332:c4562799-4562458 [Klebsiella aerogenes]
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|