Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yeeU/CbtA-CbeA
Location 4072556..4073309 Replicon chromosome
Accession NZ_CP118332
Organism Klebsiella aerogenes strain IIIF7SW-P1

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag HZS33_RS19610 Protein ID WP_085551900.1
Coordinates 4072941..4073309 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8B4G4X8
Locus tag HZS33_RS19605 Protein ID WP_032410127.1
Coordinates 4072556..4072906 (+) Length 117 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HZS33_RS19575 (4067732) 4067732..4068883 - 1152 WP_163361709.1 hypothetical protein -
HZS33_RS19580 (4068981) 4068981..4069874 + 894 WP_163361710.1 50S ribosome-binding GTPase -
HZS33_RS19585 (4070160) 4070160..4070837 + 678 WP_004129352.1 hypothetical protein -
HZS33_RS19590 (4070933) 4070933..4071754 + 822 WP_163361715.1 DUF932 domain-containing protein -
HZS33_RS19595 (4071825) 4071825..4072298 + 474 WP_032410128.1 DNA repair protein RadC -
HZS33_RS19600 (4072314) 4072314..4072535 + 222 WP_163361711.1 DUF987 family protein -
HZS33_RS19605 (4072556) 4072556..4072906 + 351 WP_032410127.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
HZS33_RS19610 (4072941) 4072941..4073309 + 369 WP_085551900.1 TA system toxin CbtA family protein Toxin
HZS33_RS19615 (4073396) 4073396..4073533 + 138 WP_179373291.1 hypothetical protein -
HZS33_RS19620 (4073658) 4073658..4073972 + 315 WP_047076161.1 DUF1493 family protein -
HZS33_RS19625 (4074081) 4074081..4074677 - 597 WP_227505132.1 helix-turn-helix domain-containing protein -
HZS33_RS19630 (4075000) 4075000..4075446 + 447 WP_047076160.1 hypothetical protein -
HZS33_RS19635 (4075440) 4075440..4075790 + 351 WP_047076159.1 DUF1493 family protein -
HZS33_RS19640 (4075898) 4075898..4077043 - 1146 WP_047076158.1 CMY2-MIR-ACT-EC family cephalosporin-hydrolyzing class C beta-lactamase -
HZS33_RS19645 (4077186) 4077186..4078076 + 891 WP_047076157.1 LysR family transcriptional regulator AmpR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4036900..4075790 38890


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-109)

Antitoxin

Antitoxin CbeA

(15-115)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13794.94 Da        Isoelectric Point: 8.2789

>T273069 WP_085551900.1 NZ_CP118332:4072941-4073309 [Klebsiella aerogenes]
MNTLPAINQRAVQTCLSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVIKRHIEAGITLVDAVNFLVEKYELIRIDRRGF
SSQGQVPYLTVTDILHARRACGLTNSCPYREVSNIVLGRSRQ

Download         Length: 369 bp

Antitoxin


Download         Length: 117 a.a.        Molecular weight: 13014.93 Da        Isoelectric Point: 7.1865

>AT273069 WP_032410127.1 NZ_CP118332:4072556-4072906 [Klebsiella aerogenes]
MSSKTLTVNDDTAEPWWGLNRNVIPCFGARLVQEGNRLYYLSDRASIIGLFNKADLLRLDQAFPVLLKQAELMLTSGELN
PRHQHCVTLYAKGLTCEADTLGSCGHVYISIYPTQR

Download         Length: 351 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A8B4G4X8

References