Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3877855..3878474 Replicon chromosome
Accession NZ_CP118332
Organism Klebsiella aerogenes strain IIIF7SW-P1

Toxin (Protein)


Gene name Hha Uniprot ID A0A0H3FXE2
Locus tag HZS33_RS18650 Protein ID WP_015367918.1
Coordinates 3878256..3878474 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0H3FPM3
Locus tag HZS33_RS18645 Protein ID WP_015367917.1
Coordinates 3877855..3878229 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HZS33_RS18635 (3873014) 3873014..3874213 + 1200 WP_020079451.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
HZS33_RS18640 (3874236) 3874236..3877382 + 3147 WP_015367916.1 multidrug efflux RND transporter permease subunit AcrB -
HZS33_RS18645 (3877855) 3877855..3878229 + 375 WP_015367917.1 Hha toxicity modulator TomB Antitoxin
HZS33_RS18650 (3878256) 3878256..3878474 + 219 WP_015367918.1 HHA domain-containing protein Toxin
HZS33_RS18655 (3878606) 3878606..3879169 + 564 WP_045361854.1 maltose O-acetyltransferase -
HZS33_RS18660 (3879144) 3879144..3879248 - 105 Protein_3657 hypothetical protein -
HZS33_RS18665 (3879295) 3879295..3879759 + 465 WP_015367920.1 YlaC family protein -
HZS33_RS18670 (3879734) 3879734..3881188 - 1455 WP_020079453.1 PLP-dependent aminotransferase family protein -
HZS33_RS18675 (3881291) 3881291..3882001 + 711 WP_032713998.1 GNAT family protein -
HZS33_RS18680 (3881998) 3881998..3882138 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
HZS33_RS18685 (3882141) 3882141..3882401 - 261 WP_015367923.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8569.96 Da        Isoelectric Point: 9.4828

>T273068 WP_015367918.1 NZ_CP118332:3878256-3878474 [Klebsiella aerogenes]
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14464.21 Da        Isoelectric Point: 4.9045

>AT273068 WP_015367917.1 NZ_CP118332:3877855-3878229 [Klebsiella aerogenes]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3FXE2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3FPM3

References