Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2578866..2579605 | Replicon | chromosome |
Accession | NZ_CP118332 | ||
Organism | Klebsiella aerogenes strain IIIF7SW-P1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A0H3G0L6 |
Locus tag | HZS33_RS12395 | Protein ID | WP_015705365.1 |
Coordinates | 2579120..2579605 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A0H3FSM9 |
Locus tag | HZS33_RS12390 | Protein ID | WP_015705366.1 |
Coordinates | 2578866..2579132 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HZS33_RS12365 (2574201) | 2574201..2574788 | + | 588 | WP_047048982.1 | hypothetical protein | - |
HZS33_RS12370 (2574785) | 2574785..2576104 | + | 1320 | WP_047076454.1 | ATP-binding protein | - |
HZS33_RS12375 (2576104) | 2576104..2576721 | + | 618 | WP_020078884.1 | response regulator | - |
HZS33_RS12380 (2576817) | 2576817..2577314 | + | 498 | WP_047076455.1 | heme-binding protein | - |
HZS33_RS12385 (2577358) | 2577358..2578593 | - | 1236 | WP_020078885.1 | MFS transporter | - |
HZS33_RS12390 (2578866) | 2578866..2579132 | + | 267 | WP_015705366.1 | DUF1778 domain-containing protein | Antitoxin |
HZS33_RS12395 (2579120) | 2579120..2579605 | + | 486 | WP_015705365.1 | GNAT family N-acetyltransferase | Toxin |
HZS33_RS12400 (2579677) | 2579677..2581293 | + | 1617 | WP_015705364.1 | FAD-NAD(P)-binding protein | - |
HZS33_RS12405 (2581412) | 2581412..2582512 | + | 1101 | WP_047076456.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
HZS33_RS12410 (2582569) | 2582569..2582727 | - | 159 | WP_002903230.1 | YqaE/Pmp3 family membrane protein | - |
HZS33_RS12415 (2582988) | 2582988..2584058 | + | 1071 | WP_020078888.1 | mannonate dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17603.25 Da Isoelectric Point: 8.8590
>T273067 WP_015705365.1 NZ_CP118332:2579120-2579605 [Klebsiella aerogenes]
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGLKNQAQGAARTFVVCKEESHQVVGFYSLATGSVNHTEATGGLRRNM
PDPIPVIILARLAIDCAYHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGLKNQAQGAARTFVVCKEESHQVVGFYSLATGSVNHTEATGGLRRNM
PDPIPVIILARLAIDCAYHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3G0L6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3FSM9 |