Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 837549..838206 | Replicon | chromosome |
Accession | NZ_CP118332 | ||
Organism | Klebsiella aerogenes strain IIIF7SW-P1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0H3FM52 |
Locus tag | HZS33_RS04090 | Protein ID | WP_015369792.1 |
Coordinates | 837796..838206 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A0H3FJK6 |
Locus tag | HZS33_RS04085 | Protein ID | WP_015369791.1 |
Coordinates | 837549..837815 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HZS33_RS04060 (832776) | 832776..834209 | - | 1434 | WP_015369787.1 | 6-phospho-beta-glucosidase BglA | - |
HZS33_RS04065 (834329) | 834329..835057 | - | 729 | WP_179373275.1 | MurR/RpiR family transcriptional regulator | - |
HZS33_RS04070 (835108) | 835108..835419 | + | 312 | WP_015369789.1 | N(4)-acetylcytidine aminohydrolase | - |
HZS33_RS04075 (835584) | 835584..836243 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
HZS33_RS04080 (836342) | 836342..837325 | - | 984 | WP_015369790.1 | tRNA-modifying protein YgfZ | - |
HZS33_RS04085 (837549) | 837549..837815 | + | 267 | WP_015369791.1 | FAD assembly factor SdhE | Antitoxin |
HZS33_RS04090 (837796) | 837796..838206 | + | 411 | WP_015369792.1 | protein YgfX | Toxin |
HZS33_RS04095 (838214) | 838214..838735 | - | 522 | WP_015369793.1 | flavodoxin FldB | - |
HZS33_RS04100 (838836) | 838836..839732 | + | 897 | WP_045414365.1 | site-specific tyrosine recombinase XerD | - |
HZS33_RS04105 (839755) | 839755..840468 | + | 714 | WP_015369795.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
HZS33_RS04110 (840474) | 840474..842207 | + | 1734 | WP_032715785.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15887.69 Da Isoelectric Point: 10.0200
>T273062 WP_015369792.1 NZ_CP118332:837796-838206 [Klebsiella aerogenes]
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3FM52 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3FJK6 |