Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 313980..314566 Replicon chromosome
Accession NZ_CP118332
Organism Klebsiella aerogenes strain IIIF7SW-P1

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag HZS33_RS01485 Protein ID WP_032709318.1
Coordinates 314198..314566 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag HZS33_RS01480 Protein ID WP_004174006.1
Coordinates 313980..314201 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HZS33_RS01460 (310121) 310121..311047 + 927 WP_015369323.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
HZS33_RS01465 (311044) 311044..312321 + 1278 WP_015369324.1 branched chain amino acid ABC transporter permease LivM -
HZS33_RS01470 (312318) 312318..313085 + 768 WP_015369325.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
HZS33_RS01475 (313103) 313103..313816 + 714 WP_026612205.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
HZS33_RS01480 (313980) 313980..314201 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HZS33_RS01485 (314198) 314198..314566 + 369 WP_032709318.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
HZS33_RS01490 (314858) 314858..316174 + 1317 WP_015703703.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
HZS33_RS01495 (316281) 316281..317168 + 888 WP_015369328.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
HZS33_RS01500 (317165) 317165..318010 + 846 WP_015369329.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
HZS33_RS01505 (318012) 318012..319082 + 1071 WP_015703701.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 311044..319819 8775


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.97 Da        Isoelectric Point: 9.7753

>T273061 WP_032709318.1 NZ_CP118332:314198-314566 [Klebsiella aerogenes]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGKLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT273061 WP_004174006.1 NZ_CP118332:313980-314201 [Klebsiella aerogenes]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References