Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 313980..314566 | Replicon | chromosome |
| Accession | NZ_CP118332 | ||
| Organism | Klebsiella aerogenes strain IIIF7SW-P1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | HZS33_RS01485 | Protein ID | WP_032709318.1 |
| Coordinates | 314198..314566 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | HZS33_RS01480 | Protein ID | WP_004174006.1 |
| Coordinates | 313980..314201 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZS33_RS01460 (310121) | 310121..311047 | + | 927 | WP_015369323.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| HZS33_RS01465 (311044) | 311044..312321 | + | 1278 | WP_015369324.1 | branched chain amino acid ABC transporter permease LivM | - |
| HZS33_RS01470 (312318) | 312318..313085 | + | 768 | WP_015369325.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| HZS33_RS01475 (313103) | 313103..313816 | + | 714 | WP_026612205.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| HZS33_RS01480 (313980) | 313980..314201 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| HZS33_RS01485 (314198) | 314198..314566 | + | 369 | WP_032709318.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| HZS33_RS01490 (314858) | 314858..316174 | + | 1317 | WP_015703703.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| HZS33_RS01495 (316281) | 316281..317168 | + | 888 | WP_015369328.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| HZS33_RS01500 (317165) | 317165..318010 | + | 846 | WP_015369329.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| HZS33_RS01505 (318012) | 318012..319082 | + | 1071 | WP_015703701.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 311044..319819 | 8775 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.97 Da Isoelectric Point: 9.7753
>T273061 WP_032709318.1 NZ_CP118332:314198-314566 [Klebsiella aerogenes]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGKLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGKLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|