Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4305443..4306050 | Replicon | chromosome |
Accession | NZ_CP118279 | ||
Organism | Enterobacter hormaechei strain LG3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A4Q4AAS0 |
Locus tag | LNGFDJGK_RS20540 | Protein ID | WP_057979982.1 |
Coordinates | 4305865..4306050 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LNGFDJGK_RS20535 | Protein ID | WP_045337117.1 |
Coordinates | 4305443..4305850 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNGFDJGK_RS20520 (LNGFDJGK_04065) | 4302186..4303439 | + | 1254 | WP_015572749.1 | valine--pyruvate transaminase | - |
LNGFDJGK_RS20525 (LNGFDJGK_04066) | 4303447..4303902 | - | 456 | WP_045337119.1 | 4Fe-4S dicluster domain-containing protein | - |
LNGFDJGK_RS20530 (LNGFDJGK_04067) | 4304363..4305439 | + | 1077 | WP_023323870.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
LNGFDJGK_RS20535 (LNGFDJGK_04068) | 4305443..4305850 | - | 408 | WP_045337117.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
LNGFDJGK_RS20540 | 4305865..4306050 | - | 186 | WP_057979982.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
LNGFDJGK_RS20545 (LNGFDJGK_04069) | 4306296..4307834 | - | 1539 | WP_006808612.1 | aldehyde dehydrogenase AldB | - |
LNGFDJGK_RS20550 (LNGFDJGK_04070) | 4308001..4308885 | + | 885 | WP_045337115.1 | ROK family protein | - |
LNGFDJGK_RS20555 (LNGFDJGK_04071) | 4308889..4310727 | - | 1839 | WP_045337113.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6852.08 Da Isoelectric Point: 11.5191
>T273059 WP_057979982.1 NZ_CP118279:c4306050-4305865 [Enterobacter hormaechei]
VKSADIITVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIITVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15263.24 Da Isoelectric Point: 4.4217
>AT273059 WP_045337117.1 NZ_CP118279:c4305850-4305443 [Enterobacter hormaechei]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEMLPLPDMVEAHLASHPEDFIGGQWL
LVDINMKQFEGRVERINITIPRRLLVKIDSFVSEHPQFTNRSAFLAEAARRVLPR
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEMLPLPDMVEAHLASHPEDFIGGQWL
LVDINMKQFEGRVERINITIPRRLLVKIDSFVSEHPQFTNRSAFLAEAARRVLPR
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|