Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3673240..3673897 | Replicon | chromosome |
Accession | NZ_CP118279 | ||
Organism | Enterobacter hormaechei strain LG3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | LNGFDJGK_RS17470 | Protein ID | WP_045337133.1 |
Coordinates | 3673240..3673650 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | LNGFDJGK_RS17475 | Protein ID | WP_003863437.1 |
Coordinates | 3673631..3673897 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNGFDJGK_RS17450 (LNGFDJGK_03456) | 3669238..3670971 | - | 1734 | WP_023314793.1 | single-stranded-DNA-specific exonuclease RecJ | - |
LNGFDJGK_RS17455 (LNGFDJGK_03457) | 3670977..3671690 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LNGFDJGK_RS17460 (LNGFDJGK_03458) | 3671719..3672615 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
LNGFDJGK_RS17465 (LNGFDJGK_03459) | 3672717..3673238 | + | 522 | WP_003863440.1 | flavodoxin FldB | - |
LNGFDJGK_RS17470 (LNGFDJGK_03460) | 3673240..3673650 | - | 411 | WP_045337133.1 | protein YgfX | Toxin |
LNGFDJGK_RS17475 (LNGFDJGK_03461) | 3673631..3673897 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
LNGFDJGK_RS17480 (LNGFDJGK_03462) | 3674192..3675172 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
LNGFDJGK_RS17485 (LNGFDJGK_03464) | 3675258..3675917 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
LNGFDJGK_RS17490 (LNGFDJGK_03465) | 3676184..3676915 | + | 732 | WP_023314798.1 | MurR/RpiR family transcriptional regulator | - |
LNGFDJGK_RS17495 (LNGFDJGK_03466) | 3677032..3678465 | + | 1434 | WP_003863430.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16289.15 Da Isoelectric Point: 11.4775
>T273058 WP_045337133.1 NZ_CP118279:c3673650-3673240 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWVLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWVLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|