Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2191697..2192436 | Replicon | chromosome |
Accession | NZ_CP118279 | ||
Organism | Enterobacter hormaechei strain LG3 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
Locus tag | LNGFDJGK_RS10495 | Protein ID | WP_003857133.1 |
Coordinates | 2191697..2192182 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A927HKN6 |
Locus tag | LNGFDJGK_RS10500 | Protein ID | WP_045336276.1 |
Coordinates | 2192170..2192436 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNGFDJGK_RS10475 (LNGFDJGK_02083) | 2187851..2188609 | - | 759 | WP_023314159.1 | trans-aconitate 2-methyltransferase | - |
LNGFDJGK_RS10480 (LNGFDJGK_02084) | 2188694..2189278 | - | 585 | WP_045336272.1 | GDP-mannose pyrophosphatase | - |
LNGFDJGK_RS10485 (LNGFDJGK_02085) | 2189365..2190123 | + | 759 | WP_045336273.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
LNGFDJGK_RS10490 (LNGFDJGK_02086) | 2190228..2191520 | + | 1293 | WP_045336275.1 | glycosyl hydrolase family 28 protein | - |
LNGFDJGK_RS10495 (LNGFDJGK_02087) | 2191697..2192182 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
LNGFDJGK_RS10500 (LNGFDJGK_02088) | 2192170..2192436 | - | 267 | WP_045336276.1 | DUF1778 domain-containing protein | Antitoxin |
LNGFDJGK_RS10505 (LNGFDJGK_02089) | 2192500..2193429 | - | 930 | WP_045336278.1 | LysR family transcriptional regulator | - |
LNGFDJGK_RS10510 (LNGFDJGK_02090) | 2193559..2194947 | + | 1389 | WP_045336280.1 | MFS transporter | - |
LNGFDJGK_RS10515 (LNGFDJGK_02091) | 2194969..2195964 | - | 996 | WP_045336282.1 | DUF2891 domain-containing protein | - |
LNGFDJGK_RS10520 (LNGFDJGK_02092) | 2195974..2196960 | - | 987 | WP_045336284.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T273051 WP_003857133.1 NZ_CP118279:c2192182-2191697 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|