Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1034913..1035533 | Replicon | chromosome |
| Accession | NZ_CP118279 | ||
| Organism | Enterobacter hormaechei strain LG3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | LNGFDJGK_RS04915 | Protein ID | WP_015571250.1 |
| Coordinates | 1034913..1035131 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | LNGFDJGK_RS04920 | Protein ID | WP_006809850.1 |
| Coordinates | 1035159..1035533 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNGFDJGK_RS04885 (LNGFDJGK_00975) | 1030925..1031185 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
| LNGFDJGK_RS04890 (LNGFDJGK_00976) | 1031188..1031328 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| LNGFDJGK_RS04895 (LNGFDJGK_00977) | 1031325..1032035 | - | 711 | WP_045337215.1 | GNAT family protein | - |
| LNGFDJGK_RS04900 (LNGFDJGK_00978) | 1032137..1033597 | + | 1461 | WP_022650494.1 | PLP-dependent aminotransferase family protein | - |
| LNGFDJGK_RS04905 (LNGFDJGK_00979) | 1033569..1034036 | - | 468 | WP_022650495.1 | YlaC family protein | - |
| LNGFDJGK_RS04910 (LNGFDJGK_00980) | 1034153..1034704 | - | 552 | WP_022650496.1 | maltose O-acetyltransferase | - |
| LNGFDJGK_RS04915 (LNGFDJGK_00981) | 1034913..1035131 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| LNGFDJGK_RS04920 (LNGFDJGK_00982) | 1035159..1035533 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| LNGFDJGK_RS04925 (LNGFDJGK_00983) | 1036043..1039189 | - | 3147 | WP_022650497.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| LNGFDJGK_RS04930 (LNGFDJGK_00984) | 1039212..1040405 | - | 1194 | WP_022650498.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T273050 WP_015571250.1 NZ_CP118279:c1035131-1034913 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT273050 WP_006809850.1 NZ_CP118279:c1035533-1035159 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |