Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 308678..309274 | Replicon | chromosome |
| Accession | NZ_CP118279 | ||
| Organism | Enterobacter hormaechei strain LG3 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A837F9W8 |
| Locus tag | LNGFDJGK_RS01485 | Protein ID | WP_023315213.1 |
| Coordinates | 308972..309274 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | LNGFDJGK_RS01480 | Protein ID | WP_023315212.1 |
| Coordinates | 308678..308965 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNGFDJGK_RS01475 (LNGFDJGK_00293) | 307050..308681 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
| LNGFDJGK_RS01480 (LNGFDJGK_00294) | 308678..308965 | - | 288 | WP_023315212.1 | putative addiction module antidote protein | Antitoxin |
| LNGFDJGK_RS01485 (LNGFDJGK_00295) | 308972..309274 | - | 303 | WP_023315213.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LNGFDJGK_RS01490 (LNGFDJGK_00296) | 309472..310344 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| LNGFDJGK_RS01495 (LNGFDJGK_00297) | 310345..310617 | - | 273 | WP_003860346.1 | DUF3811 domain-containing protein | - |
| LNGFDJGK_RS01500 (LNGFDJGK_00298) | 310668..311612 | - | 945 | WP_022650218.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| LNGFDJGK_RS01505 (LNGFDJGK_00299) | 311706..313055 | - | 1350 | WP_045337031.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11427.21 Da Isoelectric Point: 10.1042
>T273049 WP_023315213.1 NZ_CP118279:c309274-308972 [Enterobacter hormaechei]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|