Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4642613..4643126 | Replicon | chromosome |
Accession | NZ_CP118278 | ||
Organism | Klebsiella quasipneumoniae strain IIIF3SW-P1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A663BE04 |
Locus tag | HW458_RS22420 | Protein ID | WP_017900571.1 |
Coordinates | 4642613..4642894 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | HW458_RS22425 | Protein ID | WP_002886901.1 |
Coordinates | 4642884..4643126 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HW458_RS22410 (4639572) | 4639572..4641710 | + | 2139 | WP_135722534.1 | anaerobic ribonucleoside-triphosphate reductase | - |
HW458_RS22415 (4642145) | 4642145..4642609 | + | 465 | WP_032456904.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
HW458_RS22420 (4642613) | 4642613..4642894 | - | 282 | WP_017900571.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HW458_RS22425 (4642884) | 4642884..4643126 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
HW458_RS22430 (4643204) | 4643204..4645114 | - | 1911 | WP_205608966.1 | PRD domain-containing protein | - |
HW458_RS22435 (4645137) | 4645137..4646288 | - | 1152 | WP_023319593.1 | lactonase family protein | - |
HW458_RS22440 (4646355) | 4646355..4647095 | - | 741 | WP_004206507.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11082.93 Da Isoelectric Point: 10.4123
>T273047 WP_017900571.1 NZ_CP118278:c4642894-4642613 [Klebsiella quasipneumoniae]
MTYELEFDPRAWREWQLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGKR
EKAAVYHQANKRL
MTYELEFDPRAWREWQLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGKR
EKAAVYHQANKRL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A663BE04 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |