Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3935848..3936467 | Replicon | chromosome |
| Accession | NZ_CP118278 | ||
| Organism | Klebsiella quasipneumoniae strain IIIF3SW-P1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | HW458_RS19110 | Protein ID | WP_002892050.1 |
| Coordinates | 3936249..3936467 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | HW458_RS19105 | Protein ID | WP_002892066.1 |
| Coordinates | 3935848..3936222 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HW458_RS19095 (3931002) | 3931002..3932195 | + | 1194 | WP_004204747.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| HW458_RS19100 (3932218) | 3932218..3935364 | + | 3147 | WP_205608698.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| HW458_RS19105 (3935848) | 3935848..3936222 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| HW458_RS19110 (3936249) | 3936249..3936467 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| HW458_RS19115 (3936626) | 3936626..3937192 | + | 567 | WP_004204750.1 | maltose O-acetyltransferase | - |
| HW458_RS19120 (3937164) | 3937164..3937286 | - | 123 | WP_032426076.1 | hypothetical protein | - |
| HW458_RS19125 (3937329) | 3937329..3937799 | + | 471 | WP_004204751.1 | YlaC family protein | - |
| HW458_RS19130 (3937768) | 3937768..3939225 | - | 1458 | WP_205608699.1 | PLP-dependent aminotransferase family protein | - |
| HW458_RS19135 (3939326) | 3939326..3940024 | + | 699 | WP_004204753.1 | GNAT family protein | - |
| HW458_RS19140 (3940021) | 3940021..3940161 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| HW458_RS19145 (3940161) | 3940161..3940424 | - | 264 | WP_004204754.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273046 WP_002892050.1 NZ_CP118278:3936249-3936467 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT273046 WP_002892066.1 NZ_CP118278:3935848-3936222 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |