Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3935848..3936467 Replicon chromosome
Accession NZ_CP118278
Organism Klebsiella quasipneumoniae strain IIIF3SW-P1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag HW458_RS19110 Protein ID WP_002892050.1
Coordinates 3936249..3936467 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag HW458_RS19105 Protein ID WP_002892066.1
Coordinates 3935848..3936222 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HW458_RS19095 (3931002) 3931002..3932195 + 1194 WP_004204747.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
HW458_RS19100 (3932218) 3932218..3935364 + 3147 WP_205608698.1 multidrug efflux RND transporter permease subunit AcrB -
HW458_RS19105 (3935848) 3935848..3936222 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
HW458_RS19110 (3936249) 3936249..3936467 + 219 WP_002892050.1 HHA domain-containing protein Toxin
HW458_RS19115 (3936626) 3936626..3937192 + 567 WP_004204750.1 maltose O-acetyltransferase -
HW458_RS19120 (3937164) 3937164..3937286 - 123 WP_032426076.1 hypothetical protein -
HW458_RS19125 (3937329) 3937329..3937799 + 471 WP_004204751.1 YlaC family protein -
HW458_RS19130 (3937768) 3937768..3939225 - 1458 WP_205608699.1 PLP-dependent aminotransferase family protein -
HW458_RS19135 (3939326) 3939326..3940024 + 699 WP_004204753.1 GNAT family protein -
HW458_RS19140 (3940021) 3940021..3940161 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
HW458_RS19145 (3940161) 3940161..3940424 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T273046 WP_002892050.1 NZ_CP118278:3936249-3936467 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT273046 WP_002892066.1 NZ_CP118278:3935848-3936222 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References