Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 794633..795290 | Replicon | chromosome |
| Accession | NZ_CP118278 | ||
| Organism | Klebsiella quasipneumoniae strain IIIF3SW-P1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2A5MNX1 |
| Locus tag | HW458_RS03895 | Protein ID | WP_004205323.1 |
| Coordinates | 794880..795290 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | HW458_RS03890 | Protein ID | WP_002916312.1 |
| Coordinates | 794633..794899 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HW458_RS03865 (789784) | 789784..791217 | - | 1434 | WP_004205314.1 | 6-phospho-beta-glucosidase BglA | - |
| HW458_RS03870 (791336) | 791336..792064 | - | 729 | WP_004205316.1 | MurR/RpiR family transcriptional regulator | - |
| HW458_RS03875 (792114) | 792114..792425 | + | 312 | WP_004205318.1 | N(4)-acetylcytidine aminohydrolase | - |
| HW458_RS03880 (792588) | 792588..793247 | + | 660 | WP_004205319.1 | hemolysin III family protein | - |
| HW458_RS03885 (793404) | 793404..794387 | - | 984 | WP_205608766.1 | tRNA-modifying protein YgfZ | - |
| HW458_RS03890 (794633) | 794633..794899 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| HW458_RS03895 (794880) | 794880..795290 | + | 411 | WP_004205323.1 | protein YgfX | Toxin |
| HW458_RS03900 (795297) | 795297..795818 | - | 522 | WP_048325670.1 | flavodoxin FldB | - |
| HW458_RS03905 (795919) | 795919..796815 | + | 897 | WP_205608767.1 | site-specific tyrosine recombinase XerD | - |
| HW458_RS03910 (796838) | 796838..797551 | + | 714 | WP_004205326.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| HW458_RS03915 (797557) | 797557..799290 | + | 1734 | WP_004205327.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16035.83 Da Isoelectric Point: 11.4778
>T273040 WP_004205323.1 NZ_CP118278:794880-795290 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MNX1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |