Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4687886..4688399 | Replicon | chromosome |
| Accession | NZ_CP118276 | ||
| Organism | Klebsiella quasipneumoniae strain F3-6P(2) | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | HW455_RS22610 | Protein ID | WP_064190102.1 |
| Coordinates | 4687886..4688167 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | HW455_RS22615 | Protein ID | WP_002886901.1 |
| Coordinates | 4688157..4688399 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HW455_RS22595 (4682928) | 4682928..4684583 | + | 1656 | WP_064178460.1 | alpha,alpha-phosphotrehalase | - |
| HW455_RS22600 (4684969) | 4684969..4687107 | + | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| HW455_RS22605 (4687418) | 4687418..4687882 | + | 465 | WP_064190101.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| HW455_RS22610 (4687886) | 4687886..4688167 | - | 282 | WP_064190102.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HW455_RS22615 (4688157) | 4688157..4688399 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| HW455_RS22620 (4688477) | 4688477..4690387 | - | 1911 | WP_057212387.1 | PRD domain-containing protein | - |
| HW455_RS22625 (4690410) | 4690410..4691561 | - | 1152 | WP_065878155.1 | lactonase family protein | - |
| HW455_RS22630 (4691628) | 4691628..4692368 | - | 741 | WP_004206507.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11031.81 Da Isoelectric Point: 10.1752
>T273030 WP_064190102.1 NZ_CP118276:c4688167-4687886 [Klebsiella quasipneumoniae]
MTYELEFDPRAWREWQLGETVKKQFKNNLQQIMQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGKR
EKAAVYHQANKRL
MTYELEFDPRAWREWQLGETVKKQFKNNLQQIMQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGKR
EKAAVYHQANKRL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|