Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4687886..4688399 | Replicon | chromosome |
Accession | NZ_CP118276 | ||
Organism | Klebsiella quasipneumoniae strain F3-6P(2) |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | HW455_RS22610 | Protein ID | WP_064190102.1 |
Coordinates | 4687886..4688167 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | HW455_RS22615 | Protein ID | WP_002886901.1 |
Coordinates | 4688157..4688399 (-) | Length | 81 a.a. |
Genomic Context
Location: 4682928..4684583 (1656 bp)
Type: Others
Protein ID: WP_064178460.1
Type: Others
Protein ID: WP_064178460.1
Location: 4684969..4687107 (2139 bp)
Type: Others
Protein ID: WP_004206513.1
Type: Others
Protein ID: WP_004206513.1
Location: 4687418..4687882 (465 bp)
Type: Others
Protein ID: WP_064190101.1
Type: Others
Protein ID: WP_064190101.1
Location: 4687886..4688167 (282 bp)
Type: Toxin
Protein ID: WP_064190102.1
Type: Toxin
Protein ID: WP_064190102.1
Location: 4688157..4688399 (243 bp)
Type: Antitoxin
Protein ID: WP_002886901.1
Type: Antitoxin
Protein ID: WP_002886901.1
Location: 4688477..4690387 (1911 bp)
Type: Others
Protein ID: WP_057212387.1
Type: Others
Protein ID: WP_057212387.1
Location: 4690410..4691561 (1152 bp)
Type: Others
Protein ID: WP_065878155.1
Type: Others
Protein ID: WP_065878155.1
Location: 4691628..4692368 (741 bp)
Type: Others
Protein ID: WP_004206507.1
Type: Others
Protein ID: WP_004206507.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HW455_RS22595 (4682928) | 4682928..4684583 | + | 1656 | WP_064178460.1 | alpha,alpha-phosphotrehalase | - |
HW455_RS22600 (4684969) | 4684969..4687107 | + | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
HW455_RS22605 (4687418) | 4687418..4687882 | + | 465 | WP_064190101.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
HW455_RS22610 (4687886) | 4687886..4688167 | - | 282 | WP_064190102.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HW455_RS22615 (4688157) | 4688157..4688399 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
HW455_RS22620 (4688477) | 4688477..4690387 | - | 1911 | WP_057212387.1 | PRD domain-containing protein | - |
HW455_RS22625 (4690410) | 4690410..4691561 | - | 1152 | WP_065878155.1 | lactonase family protein | - |
HW455_RS22630 (4691628) | 4691628..4692368 | - | 741 | WP_004206507.1 | KDGP aldolase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11031.81 Da Isoelectric Point: 10.1752
>T273030 WP_064190102.1 NZ_CP118276:c4688167-4687886 [Klebsiella quasipneumoniae]
MTYELEFDPRAWREWQLGETVKKQFKNNLQQIMQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGKR
EKAAVYHQANKRL
MTYELEFDPRAWREWQLGETVKKQFKNNLQQIMQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGKR
EKAAVYHQANKRL
Download Length: 282 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |