Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4687871..4688384 | Replicon | chromosome |
Accession | NZ_CP118275 | ||
Organism | Klebsiella quasipneumoniae strain IF1SW-P4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | HU252_RS22610 | Protein ID | WP_064190102.1 |
Coordinates | 4687871..4688152 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | HU252_RS22615 | Protein ID | WP_002886901.1 |
Coordinates | 4688142..4688384 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HU252_RS22595 (4682913) | 4682913..4684568 | + | 1656 | WP_064178460.1 | alpha,alpha-phosphotrehalase | - |
HU252_RS22600 (4684954) | 4684954..4687092 | + | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
HU252_RS22605 (4687403) | 4687403..4687867 | + | 465 | WP_064190101.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
HU252_RS22610 (4687871) | 4687871..4688152 | - | 282 | WP_064190102.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HU252_RS22615 (4688142) | 4688142..4688384 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
HU252_RS22620 (4688462) | 4688462..4690372 | - | 1911 | WP_057212387.1 | PRD domain-containing protein | - |
HU252_RS22625 (4690395) | 4690395..4691546 | - | 1152 | WP_065878155.1 | lactonase family protein | - |
HU252_RS22630 (4691613) | 4691613..4692353 | - | 741 | WP_004206507.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11031.81 Da Isoelectric Point: 10.1752
>T273021 WP_064190102.1 NZ_CP118275:c4688152-4687871 [Klebsiella quasipneumoniae]
MTYELEFDPRAWREWQLGETVKKQFKNNLQQIMQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGKR
EKAAVYHQANKRL
MTYELEFDPRAWREWQLGETVKKQFKNNLQQIMQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGKR
EKAAVYHQANKRL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|