Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4617671..4618454 | Replicon | chromosome |
Accession | NZ_CP118274 | ||
Organism | Klebsiella quasipneumoniae strain IF1SW-P3 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | HU658_RS22305 | Protein ID | WP_069734344.1 |
Coordinates | 4617671..4618045 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | HU658_RS22310 | Protein ID | WP_069734343.1 |
Coordinates | 4618095..4618454 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HU658_RS22290 (4614007) | 4614007..4614441 | + | 435 | WP_069734348.1 | antiviral protein Drt1b | - |
HU658_RS22295 (4614742) | 4614742..4615539 | - | 798 | WP_117088841.1 | helix-turn-helix transcriptional regulator | - |
HU658_RS22300 (4616143) | 4616143..4617132 | + | 990 | WP_069734346.1 | glycosyltransferase | - |
HU658_RS22305 (4617671) | 4617671..4618045 | - | 375 | WP_069734344.1 | TA system toxin CbtA family protein | Toxin |
HU658_RS22310 (4618095) | 4618095..4618454 | - | 360 | WP_069734343.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
HU658_RS22315 (4618477) | 4618477..4618698 | - | 222 | WP_069734358.1 | DUF987 domain-containing protein | - |
HU658_RS22320 (4618712) | 4618712..4619194 | - | 483 | WP_069734342.1 | DNA repair protein RadC | - |
HU658_RS22325 (4619435) | 4619435..4619914 | - | 480 | WP_069734341.1 | antirestriction protein | - |
HU658_RS22330 (4619994) | 4619994..4620815 | - | 822 | WP_069734340.1 | DUF932 domain-containing protein | - |
HU658_RS22335 (4620926) | 4620926..4621138 | - | 213 | WP_010434180.1 | hypothetical protein | - |
HU658_RS22340 (4621219) | 4621219..4621578 | - | 360 | WP_069734339.1 | hypothetical protein | - |
HU658_RS22345 (4621633) | 4621633..4622043 | - | 411 | WP_069734357.1 | hypothetical protein | - |
HU658_RS22350 (4622151) | 4622151..4622828 | - | 678 | WP_069734338.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4614229..4639876 | 25647 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13963.97 Da Isoelectric Point: 10.1569
>T273011 WP_069734344.1 NZ_CP118274:c4618045-4617671 [Klebsiella quasipneumoniae]
MQKQSLSSHRAASSRLSSIEIWRKLLKYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSIDMLRARKATGLMTRKGYKTVTDITGDRFSGGK
MQKQSLSSHRAASSRLSSIEIWRKLLKYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSIDMLRARKATGLMTRKGYKTVTDITGDRFSGGK
Download Length: 375 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13362.56 Da Isoelectric Point: 8.5076
>AT273011 WP_069734343.1 NZ_CP118274:c4618454-4618095 [Klebsiella quasipneumoniae]
MKKATRVINHNIAEPWWGLRRNITPCLGARLVQEGNRLHYLADRASIAGTFNDADLRHLDQAFPVLMKQMELMLASRELT
PHIQRCITLHAKGLICEADTLGSCGYLYIVIYPTSATTA
MKKATRVINHNIAEPWWGLRRNITPCLGARLVQEGNRLHYLADRASIAGTFNDADLRHLDQAFPVLMKQMELMLASRELT
PHIQRCITLHAKGLICEADTLGSCGYLYIVIYPTSATTA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|