Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3964821..3965440 | Replicon | chromosome |
| Accession | NZ_CP118274 | ||
| Organism | Klebsiella quasipneumoniae strain IF1SW-P3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | HU658_RS19215 | Protein ID | WP_002892050.1 |
| Coordinates | 3965222..3965440 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | HU658_RS19210 | Protein ID | WP_002892066.1 |
| Coordinates | 3964821..3965195 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HU658_RS19200 (3959974) | 3959974..3961167 | + | 1194 | WP_004204747.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| HU658_RS19205 (3961190) | 3961190..3964336 | + | 3147 | WP_004204748.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| HU658_RS19210 (3964821) | 3964821..3965195 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| HU658_RS19215 (3965222) | 3965222..3965440 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| HU658_RS19220 (3965598) | 3965598..3966164 | + | 567 | WP_004204750.1 | maltose O-acetyltransferase | - |
| HU658_RS19225 (3966136) | 3966136..3966258 | - | 123 | WP_032426076.1 | hypothetical protein | - |
| HU658_RS19230 (3966301) | 3966301..3966771 | + | 471 | WP_004204751.1 | YlaC family protein | - |
| HU658_RS19235 (3966740) | 3966740..3968197 | - | 1458 | WP_065903537.1 | PLP-dependent aminotransferase family protein | - |
| HU658_RS19240 (3968298) | 3968298..3968996 | + | 699 | WP_064187826.1 | GNAT family protein | - |
| HU658_RS19245 (3968993) | 3968993..3969133 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| HU658_RS19250 (3969133) | 3969133..3969396 | - | 264 | WP_004204754.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273010 WP_002892050.1 NZ_CP118274:3965222-3965440 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT273010 WP_002892066.1 NZ_CP118274:3964821-3965195 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |