Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4617686..4618469 | Replicon | chromosome |
Accession | NZ_CP118273 | ||
Organism | Klebsiella quasipneumoniae strain F3-6P(1) |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | HW457_RS22305 | Protein ID | WP_069734344.1 |
Coordinates | 4617686..4618060 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | HW457_RS22310 | Protein ID | WP_069734343.1 |
Coordinates | 4618110..4618469 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HW457_RS22290 (4614022) | 4614022..4614456 | + | 435 | WP_069734348.1 | antiviral protein Drt1b | - |
HW457_RS22295 (4614757) | 4614757..4615554 | - | 798 | WP_117088841.1 | helix-turn-helix transcriptional regulator | - |
HW457_RS22300 (4616158) | 4616158..4617147 | + | 990 | WP_069734346.1 | glycosyltransferase | - |
HW457_RS22305 (4617686) | 4617686..4618060 | - | 375 | WP_069734344.1 | TA system toxin CbtA family protein | Toxin |
HW457_RS22310 (4618110) | 4618110..4618469 | - | 360 | WP_069734343.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
HW457_RS22315 (4618492) | 4618492..4618713 | - | 222 | WP_069734358.1 | DUF987 domain-containing protein | - |
HW457_RS22320 (4618727) | 4618727..4619209 | - | 483 | WP_069734342.1 | DNA repair protein RadC | - |
HW457_RS22325 (4619450) | 4619450..4619929 | - | 480 | WP_069734341.1 | antirestriction protein | - |
HW457_RS22330 (4620009) | 4620009..4620830 | - | 822 | WP_069734340.1 | DUF932 domain-containing protein | - |
HW457_RS22335 (4620941) | 4620941..4621153 | - | 213 | WP_010434180.1 | hypothetical protein | - |
HW457_RS22340 (4621234) | 4621234..4621593 | - | 360 | WP_069734339.1 | hypothetical protein | - |
HW457_RS22345 (4621648) | 4621648..4622058 | - | 411 | WP_069734357.1 | hypothetical protein | - |
HW457_RS22350 (4622166) | 4622166..4622843 | - | 678 | WP_069734338.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4614244..4639891 | 25647 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13963.97 Da Isoelectric Point: 10.1569
>T273002 WP_069734344.1 NZ_CP118273:c4618060-4617686 [Klebsiella quasipneumoniae]
MQKQSLSSHRAASSRLSSIEIWRKLLKYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSIDMLRARKATGLMTRKGYKTVTDITGDRFSGGK
MQKQSLSSHRAASSRLSSIEIWRKLLKYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSIDMLRARKATGLMTRKGYKTVTDITGDRFSGGK
Download Length: 375 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13362.56 Da Isoelectric Point: 8.5076
>AT273002 WP_069734343.1 NZ_CP118273:c4618469-4618110 [Klebsiella quasipneumoniae]
MKKATRVINHNIAEPWWGLRRNITPCLGARLVQEGNRLHYLADRASIAGTFNDADLRHLDQAFPVLMKQMELMLASRELT
PHIQRCITLHAKGLICEADTLGSCGYLYIVIYPTSATTA
MKKATRVINHNIAEPWWGLRRNITPCLGARLVQEGNRLHYLADRASIAGTFNDADLRHLDQAFPVLMKQMELMLASRELT
PHIQRCITLHAKGLICEADTLGSCGYLYIVIYPTSATTA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|