Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4687870..4688383 | Replicon | chromosome |
| Accession | NZ_CP118271 | ||
| Organism | Klebsiella quasipneumoniae strain IF2SW-B3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | HU253_RS22605 | Protein ID | WP_064190102.1 |
| Coordinates | 4687870..4688151 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | HU253_RS22610 | Protein ID | WP_002886901.1 |
| Coordinates | 4688141..4688383 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HU253_RS22590 (4682912) | 4682912..4684567 | + | 1656 | WP_064178460.1 | alpha,alpha-phosphotrehalase | - |
| HU253_RS22595 (4684953) | 4684953..4687091 | + | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| HU253_RS22600 (4687402) | 4687402..4687866 | + | 465 | WP_064190101.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| HU253_RS22605 (4687870) | 4687870..4688151 | - | 282 | WP_064190102.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HU253_RS22610 (4688141) | 4688141..4688383 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| HU253_RS22615 (4688461) | 4688461..4690371 | - | 1911 | WP_057212387.1 | PRD domain-containing protein | - |
| HU253_RS22620 (4690394) | 4690394..4691545 | - | 1152 | WP_065878155.1 | lactonase family protein | - |
| HU253_RS22625 (4691612) | 4691612..4692352 | - | 741 | WP_004206507.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11031.81 Da Isoelectric Point: 10.1752
>T272985 WP_064190102.1 NZ_CP118271:c4688151-4687870 [Klebsiella quasipneumoniae]
MTYELEFDPRAWREWQLGETVKKQFKNNLQQIMQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGKR
EKAAVYHQANKRL
MTYELEFDPRAWREWQLGETVKKQFKNNLQQIMQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGKR
EKAAVYHQANKRL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|