Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3964821..3965440 Replicon chromosome
Accession NZ_CP118271
Organism Klebsiella quasipneumoniae strain IF2SW-B3

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag HU253_RS19210 Protein ID WP_002892050.1
Coordinates 3965222..3965440 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag HU253_RS19205 Protein ID WP_002892066.1
Coordinates 3964821..3965195 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HU253_RS19195 (3959974) 3959974..3961167 + 1194 WP_004204747.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
HU253_RS19200 (3961190) 3961190..3964336 + 3147 WP_004204748.1 multidrug efflux RND transporter permease subunit AcrB -
HU253_RS19205 (3964821) 3964821..3965195 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
HU253_RS19210 (3965222) 3965222..3965440 + 219 WP_002892050.1 HHA domain-containing protein Toxin
HU253_RS19215 (3965598) 3965598..3966164 + 567 WP_004204750.1 maltose O-acetyltransferase -
HU253_RS19220 (3966136) 3966136..3966258 - 123 WP_032426076.1 hypothetical protein -
HU253_RS19225 (3966301) 3966301..3966771 + 471 WP_004204751.1 YlaC family protein -
HU253_RS19230 (3966740) 3966740..3968197 - 1458 WP_065903537.1 PLP-dependent aminotransferase family protein -
HU253_RS19235 (3968298) 3968298..3968996 + 699 WP_064187826.1 GNAT family protein -
HU253_RS19240 (3968993) 3968993..3969133 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
HU253_RS19245 (3969133) 3969133..3969396 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T272983 WP_002892050.1 NZ_CP118271:3965222-3965440 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT272983 WP_002892066.1 NZ_CP118271:3964821-3965195 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References