Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 2651736..2652371 | Replicon | chromosome |
| Accession | NZ_CP118270 | ||
| Organism | Paenibacillus marchantiae strain BMpBG1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | W4B4V0 |
| Locus tag | PTQ21_RS11935 | Protein ID | WP_024630714.1 |
| Coordinates | 2652021..2652371 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PTQ21_RS11930 | Protein ID | WP_274569993.1 |
| Coordinates | 2651736..2652017 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTQ21_RS11915 (PTQ21_11915) | 2646836..2648329 | - | 1494 | WP_274569991.1 | serine hydrolase | - |
| PTQ21_RS11920 (PTQ21_11920) | 2648625..2649827 | + | 1203 | WP_274569992.1 | outer membrane lipoprotein-sorting protein | - |
| PTQ21_RS11925 (PTQ21_11925) | 2650287..2651474 | + | 1188 | WP_064640023.1 | alanine racemase | - |
| PTQ21_RS11930 (PTQ21_11930) | 2651736..2652017 | + | 282 | WP_274569993.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| PTQ21_RS11935 (PTQ21_11935) | 2652021..2652371 | + | 351 | WP_024630714.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PTQ21_RS11940 (PTQ21_11940) | 2652606..2654795 | + | 2190 | WP_274569994.1 | alpha-galactosidase | - |
| PTQ21_RS11945 (PTQ21_11945) | 2655070..2657292 | + | 2223 | WP_063564442.1 | Tex family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12778.77 Da Isoelectric Point: 5.1184
>T272976 WP_024630714.1 NZ_CP118270:2652021-2652371 [Paenibacillus marchantiae]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMKLVNEALQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMKLVNEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|