Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 3451213..3451916 | Replicon | chromosome |
Accession | NZ_CP118269 | ||
Organism | Pantoea sp. Lij88 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | PU624_RS20035 | Protein ID | WP_283546362.1 |
Coordinates | 3451213..3451554 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | PU624_RS20040 | Protein ID | WP_283546363.1 |
Coordinates | 3451575..3451916 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU624_RS20020 (PU624_20020) | 3446569..3446830 | - | 262 | Protein_3150 | hypothetical protein | - |
PU624_RS20025 (PU624_20025) | 3446999..3447946 | - | 948 | WP_283546360.1 | hypothetical protein | - |
PU624_RS20030 (PU624_20030) | 3448988..3451021 | + | 2034 | WP_283546361.1 | hypothetical protein | - |
PU624_RS20035 (PU624_20035) | 3451213..3451554 | - | 342 | WP_283546362.1 | TA system toxin CbtA family protein | Toxin |
PU624_RS20040 (PU624_20040) | 3451575..3451916 | - | 342 | WP_283546363.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PU624_RS20045 (PU624_20045) | 3451927..3452160 | - | 234 | Protein_3155 | JAB domain-containing protein | - |
PU624_RS20050 (PU624_20050) | 3452866..3454602 | + | 1737 | WP_283546364.1 | hypothetical protein | - |
PU624_RS20055 (PU624_20055) | 3455219..3456277 | + | 1059 | WP_283546365.1 | DNA cytosine methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3446999..3471019 | 24020 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12834.92 Da Isoelectric Point: 10.3456
>T272974 WP_283546362.1 NZ_CP118269:c3451554-3451213 [Pantoea sp. Lij88]
MKTLPATTQRAAKLCLSSVAVWQMLLARLLEQHYGLILNDTPFSNEAVIQEHINAGINLAGAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLRRSCKNAVR
MKTLPATTQRAAKLCLSSVAVWQMLLARLLEQHYGLILNDTPFSNEAVIQEHINAGINLAGAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLRRSCKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|