Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3017588..3018205 Replicon chromosome
Accession NZ_CP118269
Organism Pantoea sp. Lij88

Toxin (Protein)


Gene name Hha Uniprot ID E0LTU7
Locus tag PU624_RS18020 Protein ID WP_003850458.1
Coordinates 3017990..3018205 (+) Length 72 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID E0LTU8
Locus tag PU624_RS18015 Protein ID WP_003850455.1
Coordinates 3017588..3017965 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PU624_RS17985 (PU624_17985) 3013896..3014150 + 255 WP_136196485.1 type B 50S ribosomal protein L31 -
PU624_RS17990 (PU624_17990) 3014162..3014302 + 141 WP_090963213.1 type B 50S ribosomal protein L36 -
PU624_RS17995 (PU624_17995) 3014348..3015226 - 879 WP_283546069.1 metal ABC transporter substrate-binding protein -
PU624_RS18000 (PU624_18000) 3015242..3016081 - 840 WP_283546070.1 metal ABC transporter permease -
PU624_RS18005 (PU624_18005) 3016078..3016746 - 669 WP_283546071.1 ABC transporter ATP-binding protein -
PU624_RS18010 (PU624_18010) 3017087..3017440 + 354 WP_283546072.1 hypothetical protein -
PU624_RS18015 (PU624_18015) 3017588..3017965 + 378 WP_003850455.1 Hha toxicity modulator TomB Antitoxin
PU624_RS18020 (PU624_18020) 3017990..3018205 + 216 WP_003850458.1 HHA domain-containing protein Toxin
PU624_RS18030 (PU624_18030) 3018617..3018961 + 345 WP_283546073.1 MGMT family protein -
PU624_RS18035 (PU624_18035) 3018963..3019520 - 558 WP_283546074.1 YbaY family lipoprotein -
PU624_RS18040 (PU624_18040) 3019711..3020574 + 864 WP_283546075.1 acyl-CoA thioesterase II -
PU624_RS18045 (PU624_18045) 3020625..3021914 - 1290 WP_283546076.1 ammonium transporter AmtB -
PU624_RS18050 (PU624_18050) 3021949..3022287 - 339 WP_003850469.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(12-68)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 72 a.a.        Molecular weight: 8510.90 Da        Isoelectric Point: 9.4825

>T272973 WP_003850458.1 NZ_CP118269:3017990-3018205 [Pantoea sp. Lij88]
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR

Download         Length: 216 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14636.25 Da        Isoelectric Point: 4.3976

>AT272973 WP_003850455.1 NZ_CP118269:3017588-3017965 [Pantoea sp. Lij88]
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGVNSPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I5AGC3

Antitoxin

Source ID Structure
AlphaFold DB A0A1I5AG55

References