Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1385230..1385873 | Replicon | chromosome |
Accession | NZ_CP118269 | ||
Organism | Pantoea sp. Lij88 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | PU624_RS10240 | Protein ID | WP_283547520.1 |
Coordinates | 1385230..1385646 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | PU624_RS10245 | Protein ID | WP_283547521.1 |
Coordinates | 1385643..1385873 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU624_RS10215 (PU624_10215) | 1381147..1381722 | - | 576 | WP_090959377.1 | bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase | - |
PU624_RS10220 (PU624_10220) | 1382235..1382942 | - | 708 | WP_283547517.1 | phosphatase PAP2 family protein | - |
PU624_RS10225 (PU624_10225) | 1382988..1383956 | - | 969 | WP_283547518.1 | GTP-binding protein | - |
PU624_RS10230 (PU624_10230) | 1384032..1384604 | - | 573 | WP_003854146.1 | elongation factor P-like protein YeiP | - |
PU624_RS10235 (PU624_10235) | 1384936..1385190 | + | 255 | WP_283547519.1 | YkgJ family cysteine cluster protein | - |
PU624_RS10240 (PU624_10240) | 1385230..1385646 | - | 417 | WP_283547520.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PU624_RS10245 (PU624_10245) | 1385643..1385873 | - | 231 | WP_283547521.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PU624_RS10250 (PU624_10250) | 1386378..1387508 | + | 1131 | WP_283547522.1 | fused PTS fructose transporter subunit IIA/HPr protein | - |
PU624_RS10255 (PU624_10255) | 1387505..1388443 | + | 939 | WP_090959394.1 | 1-phosphofructokinase | - |
PU624_RS10260 (PU624_10260) | 1388460..1390172 | + | 1713 | WP_283547523.1 | PTS fructose transporter subunit IIBC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15280.63 Da Isoelectric Point: 8.5382
>T272969 WP_283547520.1 NZ_CP118269:c1385646-1385230 [Pantoea sp. Lij88]
VNKTYMLDTNICSFIMREQPEEVIRRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHMHLVDAFCARLDAVLSWDRA
AVDATTEIKAALAAAGTPIGPNDTAIAGHAIAARAILVTNNTREFQRVPGLQLEDWVR
VNKTYMLDTNICSFIMREQPEEVIRRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHMHLVDAFCARLDAVLSWDRA
AVDATTEIKAALAAAGTPIGPNDTAIAGHAIAARAILVTNNTREFQRVPGLQLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|