Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 4988561..4989192 Replicon chromosome
Accession NZ_CP118233
Organism Micromonospora chalcea strain 1K05785M01

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PVK74_RS22285 Protein ID WP_274477130.1
Coordinates 4988561..4988986 (-) Length 142 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID W7W0D3
Locus tag PVK74_RS22290 Protein ID WP_030500628.1
Coordinates 4988983..4989192 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVK74_RS22270 (PVK74_22270) 4985074..4986174 - 1101 WP_274477127.1 serine hydrolase domain-containing protein -
PVK74_RS22275 (PVK74_22275) 4986267..4987751 + 1485 WP_274477128.1 FAD-dependent oxidoreductase -
PVK74_RS22280 (PVK74_22280) 4987756..4988520 - 765 WP_274477129.1 crotonase/enoyl-CoA hydratase family protein -
PVK74_RS22285 (PVK74_22285) 4988561..4988986 - 426 WP_274477130.1 PIN domain nuclease Toxin
PVK74_RS22290 (PVK74_22290) 4988983..4989192 - 210 WP_030500628.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PVK74_RS22295 (PVK74_22295) 4989303..4990154 + 852 WP_274477131.1 Rieske 2Fe-2S domain-containing protein -
PVK74_RS22300 (PVK74_22300) 4990156..4991166 - 1011 WP_274477132.1 LysM domain-containing protein -
PVK74_RS22305 (PVK74_22305) 4991182..4991613 - 432 WP_274477133.1 hypothetical protein -
PVK74_RS22310 (PVK74_22310) 4991610..4992083 - 474 WP_274477134.1 TadE/TadG family type IV pilus assembly protein -
PVK74_RS22315 (PVK74_22315) 4992080..4992562 - 483 WP_069088178.1 TadE/TadG family type IV pilus assembly protein -
PVK74_RS22320 (PVK74_22320) 4992562..4992771 - 210 WP_013283462.1 hypothetical protein -
PVK74_RS22325 (PVK74_22325) 4992795..4993655 - 861 WP_043330747.1 type II secretion system F family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(6-35)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15778.12 Da        Isoelectric Point: 6.2313

>T272963 WP_274477130.1 NZ_CP118233:c4988986-4988561 [Micromonospora chalcea]
VKLADYLIDTSALVRLLRDPDVLARWEQQVTAGLLAVCPLVELEFLYTARSVADRTRLTEQLRAAFGWVVMPDRIYERAA
EIQGELTVRGTHRSAGAVDLLIAATAEYHGLSLLHYDRDFDQVGAVTGQPMRWLTRPGSIK

Download         Length: 426 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 7465.38 Da        Isoelectric Point: 4.7872

>AT272963 WP_030500628.1 NZ_CP118233:c4989192-4988983 [Micromonospora chalcea]
MTKILVDVDDEALADAAEAFGTKTKKDTVNVALREGAARLRRARALAELAERGQAGDFDELLDKGAYRS

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q5HSK6

References