Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3242576..3243201 Replicon chromosome
Accession NZ_CP118233
Organism Micromonospora chalcea strain 1K05785M01

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PVK74_RS13920 Protein ID WP_064448209.1
Coordinates 3242782..3243201 (+) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID W7VW07
Locus tag PVK74_RS13915 Protein ID WP_043329142.1
Coordinates 3242576..3242785 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVK74_RS13890 (PVK74_13890) 3237783..3238940 - 1158 WP_210872684.1 histidine kinase -
PVK74_RS13895 (PVK74_13895) 3238962..3239759 - 798 WP_205797327.1 ABC transporter permease -
PVK74_RS13900 (PVK74_13900) 3239776..3240660 - 885 WP_043329147.1 ABC transporter ATP-binding protein -
PVK74_RS13905 (PVK74_13905) 3240770..3241513 - 744 WP_274479185.1 3-oxoacyl-ACP reductase family protein -
PVK74_RS13910 (PVK74_13910) 3241651..3242502 + 852 WP_274479186.1 alpha/beta fold hydrolase -
PVK74_RS13915 (PVK74_13915) 3242576..3242785 + 210 WP_043329142.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PVK74_RS13920 (PVK74_13920) 3242782..3243201 + 420 WP_064448209.1 PIN domain nuclease Toxin
PVK74_RS13925 (PVK74_13925) 3243215..3243625 - 411 WP_069088896.1 PIN domain-containing protein -
PVK74_RS13930 (PVK74_13930) 3243622..3243906 - 285 WP_121685563.1 hypothetical protein -
PVK74_RS13935 (PVK74_13935) 3243972..3244226 - 255 WP_274479187.1 hypothetical protein -
PVK74_RS13940 (PVK74_13940) 3244223..3244537 - 315 WP_269704675.1 DivIVA domain-containing protein -
PVK74_RS13945 (PVK74_13945) 3244808..3245644 + 837 WP_113972633.1 helix-turn-helix transcriptional regulator -
PVK74_RS13950 (PVK74_13950) 3245658..3245864 + 207 WP_274479188.1 DUF397 domain-containing protein -
PVK74_RS13955 (PVK74_13955) 3245957..3246379 + 423 WP_274479189.1 hypothetical protein -
PVK74_RS13960 (PVK74_13960) 3246441..3247412 + 972 WP_274479190.1 phospholipase D family protein -
PVK74_RS13965 (PVK74_13965) 3247443..3247859 + 417 WP_274479191.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-119)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15362.61 Da        Isoelectric Point: 6.3293

>T272962 WP_064448209.1 NZ_CP118233:3242782-3243201 [Micromonospora chalcea]
MTRERYLLDKSALARWPKPAVAPVLDELSERGLLAVCGAVEIEVVHSARSAKDAQRARWLLRGFDWLAMPDDIWDRAIDV
QVQALHKGNHRALSMADLLIAATAERHGVTVLHYDGDFDLITAITGQPTTWVVPAGKAD

Download         Length: 420 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 7434.30 Da        Isoelectric Point: 4.3719

>AT272962 WP_043329142.1 NZ_CP118233:3242576-3242785 [Micromonospora chalcea]
VSRTILDVDDDLLAEAAEILGTGTKKATVNAALQEVVNREKRREFADWLKSGGLPDLTDPQQASKPEAA

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A505HRS2

References