Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3924260..3925061 Replicon chromosome
Accession NZ_CP118227
Organism Proteus mirabilis strain CY32

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0E0XS49
Locus tag PU712_RS18380 Protein ID WP_001094437.1
Coordinates 3924260..3924637 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0E0XTQ1
Locus tag PU712_RS18385 Protein ID WP_001390338.1
Coordinates 3924684..3925061 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PU712_RS18345 (PU712_18345) 3919681..3920001 - 321 WP_004246668.1 helix-turn-helix transcriptional regulator -
PU712_RS18350 (PU712_18350) 3920772..3920924 + 153 Protein_3564 integrase core domain-containing protein -
PU712_RS18355 (PU712_18355) 3921049..3922083 - 1035 WP_104836828.1 RhuM family protein -
PU712_RS18360 (PU712_18360) 3922223..3922387 - 165 Protein_3566 DUF945 domain-containing protein -
PU712_RS18365 (PU712_18365) 3922628..3923473 - 846 WP_001274561.1 DUF4942 domain-containing protein -
PU712_RS18370 (PU712_18370) 3923558..3923755 - 198 WP_000772032.1 DUF957 domain-containing protein -
PU712_RS18375 (PU712_18375) 3923775..3924263 - 489 WP_000761716.1 DUF5983 family protein -
PU712_RS18380 (PU712_18380) 3924260..3924637 - 378 WP_001094437.1 TA system toxin CbtA family protein Toxin
PU712_RS18385 (PU712_18385) 3924684..3925061 - 378 WP_001390338.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PU712_RS18390 (PU712_18390) 3925224..3925445 - 222 WP_000692345.1 DUF987 domain-containing protein -
PU712_RS18395 (PU712_18395) 3925508..3925984 - 477 WP_001535682.1 RadC family protein -
PU712_RS18400 (PU712_18400) 3926000..3926473 - 474 WP_000855064.1 antirestriction protein -
PU712_RS18405 (PU712_18405) 3926815..3927633 - 819 WP_001535681.1 DUF932 domain-containing protein -
PU712_RS18410 (PU712_18410) 3927751..3927946 - 196 Protein_3576 DUF905 family protein -
PU712_RS18415 (PU712_18415) 3928017..3928856 - 840 Protein_3577 autotransporter domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13986.90 Da        Isoelectric Point: 7.3223

>T272961 WP_001094437.1 NZ_CP118227:c3924637-3924260 [Proteus mirabilis]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13745.44 Da        Isoelectric Point: 5.0463

>AT272961 WP_001390338.1 NZ_CP118227:c3925061-3924684 [Proteus mirabilis]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0XS49

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0XTQ1

References