Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 3764236..3764885 | Replicon | chromosome |
Accession | NZ_CP118227 | ||
Organism | Proteus mirabilis strain CY32 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B4EZB9 |
Locus tag | PU712_RS17635 | Protein ID | WP_012368534.1 |
Coordinates | 3764236..3764655 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B4EZC0 |
Locus tag | PU712_RS17640 | Protein ID | WP_012368535.1 |
Coordinates | 3764652..3764885 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU712_RS17605 (PU712_17605) | 3759514..3760392 | - | 879 | WP_004246812.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
PU712_RS17610 (PU712_17610) | 3760568..3761482 | - | 915 | WP_004246811.1 | fatty acid biosynthesis protein FabY | - |
PU712_RS17615 (PU712_17615) | 3761506..3761943 | - | 438 | WP_004246810.1 | D-aminoacyl-tRNA deacylase | - |
PU712_RS17620 (PU712_17620) | 3762024..3762641 | - | 618 | WP_020946398.1 | glucose-1-phosphatase | - |
PU712_RS17625 (PU712_17625) | 3763294..3763710 | - | 417 | WP_046334846.1 | hypothetical protein | - |
PU712_RS17630 (PU712_17630) | 3763688..3763966 | - | 279 | WP_230629709.1 | hypothetical protein | - |
PU712_RS17635 (PU712_17635) | 3764236..3764655 | - | 420 | WP_012368534.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PU712_RS17640 (PU712_17640) | 3764652..3764885 | - | 234 | WP_012368535.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PU712_RS17645 (PU712_17645) | 3766176..3766376 | + | 201 | WP_104836792.1 | hypothetical protein | - |
PU712_RS17650 (PU712_17650) | 3766634..3767584 | - | 951 | WP_104836793.1 | reverse transcriptase family protein | - |
PU712_RS17655 (PU712_17655) | 3767577..3767723 | - | 147 | WP_158660334.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15371.88 Da Isoelectric Point: 7.7288
>T272960 WP_012368534.1 NZ_CP118227:c3764655-3764236 [Proteus mirabilis]
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|