272959

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) VapXD/-
Location 3400119..3400589 Replicon chromosome
Accession NZ_CP118227
Organism Proteus mirabilis strain CY32

Toxin (Protein)


Gene name VapD Uniprot ID A0A8E4FU70
Locus tag PU712_RS15975 Protein ID WP_060555119.1
Coordinates 3400311..3400589 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name VapX Uniprot ID A0A8E4FTC4
Locus tag PU712_RS15970 Protein ID WP_060555126.1
Coordinates 3400119..3400307 (+) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PU712_RS15930 (PU712_15930) 3395427..3396626 - 1200 WP_049218680.1 lipoprotein-releasing ABC transporter permease subunit LolC -
PU712_RS15935 (PU712_15935) 3396928..3397329 + 402 WP_049218678.1 g-type lysoyme inhibitor PliG -
PU712_RS15940 (PU712_15940) 3397746..3398147 - 402 WP_060555124.1 phage holin family protein -
PU712_RS15945 (PU712_15945) 3398229..3398582 - 354 WP_060555123.1 hypothetical protein -
PU712_RS15950 (PU712_15950) 3398654..3398902 - 249 WP_060555122.1 DUF883 family protein -
PU712_RS15955 (PU712_15955) 3399352..3399699 + 348 WP_060555121.1 type II toxin-antitoxin system RelE/ParE family toxin -
PU712_RS15960 (PU712_15960) 3399699..3399998 + 300 WP_060555120.1 XRE family transcriptional regulator -
PU712_RS15965 (PU712_15965) 3400017..3400121 + 105 Protein_3094 transcriptional regulator -
PU712_RS15970 (PU712_15970) 3400119..3400307 + 189 WP_060555126.1 DUF5397 family protein Antitoxin
PU712_RS15975 (PU712_15975) 3400311..3400589 + 279 WP_060555119.1 virulence factor Toxin
PU712_RS15980 (PU712_15980) 3401050..3402540 + 1491 WP_060555118.1 YadA-like family protein -
PU712_RS15985 (PU712_15985) 3402727..3402801 - 75 Protein_3098 IS200/IS605 family transposase -
PU712_RS15990 (PU712_15990) 3402795..3402902 - 108 Protein_3099 transposase -
PU712_RS15995 (PU712_15995) 3402952..3403158 - 207 WP_060555117.1 plasmid partition protein ParG -
PU712_RS16000 (PU712_16000) 3403155..3403778 - 624 WP_060555116.1 ParA family protein -
PU712_RS16005 (PU712_16005) 3404247..3404765 - 519 WP_060555115.1 ClbS/DfsB family four-helix bundle protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(J) / blaCMY-2 - 3249958..3444614 194656


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Virulence-associated protein D / CRISPR associated protein Cas2

(1-86)

Antitoxin

Protein of unknown function DUF5397

(5-62)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10589.85 Da        Isoelectric Point: 6.4606

>T272959 WP_060555119.1 NZ_CP118227:3400311-3400589 [Proteus mirabilis]
MYAISFDLTVADTEKHHPKGVSQAYNDISSTLKRYGFERIQGSLYTNSDENMANLFQAMNALKALEWFPNSVRDIRAFRI
EQWSDFTSSMKG

Download         Length: 279 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6787.78 Da        Isoelectric Point: 3.9020

>AT272959 WP_060555126.1 NZ_CP118227:3400119-3400307 [Proteus mirabilis]
MNTVQIPTGSIKTFGLFGIPYEVGEPAQELPDGDILVNIILVQTGEKELYKLSKLLQDPDAE

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References