Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5699978..5700588 | Replicon | chromosome |
| Accession | NZ_CP118223 | ||
| Organism | Klebsiella grimontii strain YWC001 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PVK07_RS26790 | Protein ID | WP_098363641.1 |
| Coordinates | 5699978..5700352 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PVK07_RS26795 | Protein ID | WP_077265771.1 |
| Coordinates | 5700349..5700588 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK07_RS26775 (PVK07_26775) | 5697133..5698035 | + | 903 | WP_201160658.1 | formate dehydrogenase subunit beta | - |
| PVK07_RS26780 (PVK07_26780) | 5698032..5698667 | + | 636 | WP_004132860.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PVK07_RS26785 (PVK07_26785) | 5699011..5699940 | + | 930 | WP_131931038.1 | formate dehydrogenase accessory protein FdhE | - |
| PVK07_RS26790 (PVK07_26790) | 5699978..5700352 | - | 375 | WP_098363641.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PVK07_RS26795 (PVK07_26795) | 5700349..5700588 | - | 240 | WP_077265771.1 | CopG family transcriptional regulator | Antitoxin |
| PVK07_RS26800 (PVK07_26800) | 5700794..5701711 | + | 918 | WP_024360706.1 | alpha/beta hydrolase | - |
| PVK07_RS26805 (PVK07_26805) | 5701729..5702670 | - | 942 | WP_004127112.1 | fatty acid biosynthesis protein FabY | - |
| PVK07_RS26810 (PVK07_26810) | 5702715..5703152 | - | 438 | WP_004132870.1 | D-aminoacyl-tRNA deacylase | - |
| PVK07_RS26815 (PVK07_26815) | 5703149..5704009 | - | 861 | WP_004127107.1 | virulence factor BrkB family protein | - |
| PVK07_RS26820 (PVK07_26820) | 5704003..5704602 | - | 600 | WP_004132872.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14081.36 Da Isoelectric Point: 8.4571
>T272954 WP_098363641.1 NZ_CP118223:c5700352-5699978 [Klebsiella grimontii]
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWTEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITPYHL
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWTEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|