Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4354857..4355476 Replicon chromosome
Accession NZ_CP118223
Organism Klebsiella grimontii strain YWC001

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag PVK07_RS20490 Protein ID WP_004099646.1
Coordinates 4355258..4355476 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID H3N7X7
Locus tag PVK07_RS20485 Protein ID WP_004129911.1
Coordinates 4354857..4355231 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVK07_RS20475 (PVK07_20475) 4350026..4351219 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PVK07_RS20480 (PVK07_20480) 4351242..4354388 + 3147 WP_004848339.1 multidrug efflux RND transporter permease subunit AcrB -
PVK07_RS20485 (PVK07_20485) 4354857..4355231 + 375 WP_004129911.1 Hha toxicity modulator TomB Antitoxin
PVK07_RS20490 (PVK07_20490) 4355258..4355476 + 219 WP_004099646.1 HHA domain-containing protein Toxin
PVK07_RS20495 (PVK07_20495) 4355638..4356204 + 567 WP_004136050.1 maltose O-acetyltransferase -
PVK07_RS20500 (PVK07_20500) 4356176..4356310 - 135 WP_223226911.1 hypothetical protein -
PVK07_RS20505 (PVK07_20505) 4356331..4356801 + 471 WP_004136048.1 YlaC family protein -
PVK07_RS20510 (PVK07_20510) 4356776..4358230 - 1455 WP_024359024.1 PLP-dependent aminotransferase family protein -
PVK07_RS20515 (PVK07_20515) 4358331..4359029 + 699 WP_004136044.1 GNAT family protein -
PVK07_RS20520 (PVK07_20520) 4359026..4359166 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
PVK07_RS20525 (PVK07_20525) 4359166..4359429 - 264 WP_004129897.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T272952 WP_004099646.1 NZ_CP118223:4355258-4355476 [Klebsiella grimontii]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14350.09 Da        Isoelectric Point: 4.8989

>AT272952 WP_004129911.1 NZ_CP118223:4354857-4355231 [Klebsiella grimontii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3HD25

References