Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4354857..4355476 | Replicon | chromosome |
| Accession | NZ_CP118223 | ||
| Organism | Klebsiella grimontii strain YWC001 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | PVK07_RS20490 | Protein ID | WP_004099646.1 |
| Coordinates | 4355258..4355476 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | H3N7X7 |
| Locus tag | PVK07_RS20485 | Protein ID | WP_004129911.1 |
| Coordinates | 4354857..4355231 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK07_RS20475 (PVK07_20475) | 4350026..4351219 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PVK07_RS20480 (PVK07_20480) | 4351242..4354388 | + | 3147 | WP_004848339.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PVK07_RS20485 (PVK07_20485) | 4354857..4355231 | + | 375 | WP_004129911.1 | Hha toxicity modulator TomB | Antitoxin |
| PVK07_RS20490 (PVK07_20490) | 4355258..4355476 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| PVK07_RS20495 (PVK07_20495) | 4355638..4356204 | + | 567 | WP_004136050.1 | maltose O-acetyltransferase | - |
| PVK07_RS20500 (PVK07_20500) | 4356176..4356310 | - | 135 | WP_223226911.1 | hypothetical protein | - |
| PVK07_RS20505 (PVK07_20505) | 4356331..4356801 | + | 471 | WP_004136048.1 | YlaC family protein | - |
| PVK07_RS20510 (PVK07_20510) | 4356776..4358230 | - | 1455 | WP_024359024.1 | PLP-dependent aminotransferase family protein | - |
| PVK07_RS20515 (PVK07_20515) | 4358331..4359029 | + | 699 | WP_004136044.1 | GNAT family protein | - |
| PVK07_RS20520 (PVK07_20520) | 4359026..4359166 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| PVK07_RS20525 (PVK07_20525) | 4359166..4359429 | - | 264 | WP_004129897.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T272952 WP_004099646.1 NZ_CP118223:4355258-4355476 [Klebsiella grimontii]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT272952 WP_004129911.1 NZ_CP118223:4354857-4355231 [Klebsiella grimontii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3HD25 |