Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 846407..847064 | Replicon | chromosome |
| Accession | NZ_CP118223 | ||
| Organism | Klebsiella grimontii strain YWC001 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A9E1DA00 |
| Locus tag | PVK07_RS04110 | Protein ID | WP_024358614.1 |
| Coordinates | 846654..847064 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | H3N295 |
| Locus tag | PVK07_RS04105 | Protein ID | WP_004124953.1 |
| Coordinates | 846407..846673 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK07_RS04090 (PVK07_04090) | 841659..842084 | - | 426 | WP_024358617.1 | PTS sugar transporter subunit IIA | - |
| PVK07_RS04095 (PVK07_04095) | 842205..845003 | - | 2799 | WP_024358616.1 | transcriptional regulator DagR | - |
| PVK07_RS04100 (PVK07_04100) | 845179..846162 | - | 984 | WP_024358615.1 | tRNA-modifying protein YgfZ | - |
| PVK07_RS04105 (PVK07_04105) | 846407..846673 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
| PVK07_RS04110 (PVK07_04110) | 846654..847064 | + | 411 | WP_024358614.1 | protein YgfX | Toxin |
| PVK07_RS04115 (PVK07_04115) | 847073..847594 | - | 522 | WP_024358613.1 | flavodoxin FldB | - |
| PVK07_RS04120 (PVK07_04120) | 847716..848612 | + | 897 | WP_004124942.1 | site-specific tyrosine recombinase XerD | - |
| PVK07_RS04125 (PVK07_04125) | 848635..849348 | + | 714 | WP_004134425.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PVK07_RS04130 (PVK07_04130) | 849354..851087 | + | 1734 | WP_131930459.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16135.97 Da Isoelectric Point: 10.9455
>T272945 WP_024358614.1 NZ_CP118223:846654-847064 [Klebsiella grimontii]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWEIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWEIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|