Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 759671..760449 | Replicon | chromosome |
Accession | NZ_CP118223 | ||
Organism | Klebsiella grimontii strain YWC001 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | PVK07_RS03665 | Protein ID | WP_148866084.1 |
Coordinates | 759961..760449 (+) | Length | 163 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A2J5Q8I3 |
Locus tag | PVK07_RS03660 | Protein ID | WP_049101739.1 |
Coordinates | 759671..759964 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVK07_RS03645 (PVK07_03645) | 754827..755972 | - | 1146 | WP_014839554.1 | PLP-dependent aspartate aminotransferase family protein | - |
PVK07_RS03650 (PVK07_03650) | 755983..757353 | - | 1371 | WP_049089071.1 | cystathionine beta-synthase | - |
PVK07_RS03655 (PVK07_03655) | 757899..759287 | + | 1389 | WP_049085001.1 | DASS family sodium-coupled anion symporter | - |
PVK07_RS03660 (PVK07_03660) | 759671..759964 | + | 294 | WP_049101739.1 | DUF1778 domain-containing protein | Antitoxin |
PVK07_RS03665 (PVK07_03665) | 759961..760449 | + | 489 | WP_148866084.1 | GNAT family N-acetyltransferase | Toxin |
PVK07_RS03670 (PVK07_03670) | 760747..761676 | - | 930 | WP_148866082.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
PVK07_RS03675 (PVK07_03675) | 761663..762445 | - | 783 | WP_177911274.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
PVK07_RS03680 (PVK07_03680) | 762768..763739 | + | 972 | WP_148866080.1 | DUF4747 family protein | - |
PVK07_RS03685 (PVK07_03685) | 763769..764326 | + | 558 | WP_148866078.1 | hypothetical protein | - |
PVK07_RS03690 (PVK07_03690) | 764391..764552 | - | 162 | Protein_725 | helix-turn-helix transcriptional regulator | - |
PVK07_RS03695 (PVK07_03695) | 764896..765357 | + | 462 | WP_148866076.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 17510.49 Da Isoelectric Point: 7.7529
>T272943 WP_148866084.1 NZ_CP118223:759961-760449 [Klebsiella grimontii]
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQLSGASRTFVCCDDAKVMAYYSLASSAVATNTAPGHFRRNMPDPI
PVVVLGRLAVDKSLHGKGLGRALIRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMLMVTLGDLVG
SV
MISAPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQLSGASRTFVCCDDAKVMAYYSLASSAVATNTAPGHFRRNMPDPI
PVVVLGRLAVDKSLHGKGLGRALIRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMLMVTLGDLVG
SV
Download Length: 489 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|