Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1324018..1324934 | Replicon | chromosome |
| Accession | NZ_CP118167 | ||
| Organism | Bacillus subtilis strain 21855 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | PUW21_RS06950 | Protein ID | WP_003244695.1 |
| Coordinates | 1324188..1324934 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | PUW21_RS06945 | Protein ID | WP_003232646.1 |
| Coordinates | 1324018..1324188 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW21_RS06910 (1320881) | 1320881..1321210 | + | 330 | WP_003232660.1 | XkdW family protein | - |
| PUW21_RS06915 (1321207) | 1321207..1321371 | + | 165 | WP_003232658.1 | XkdX family protein | - |
| PUW21_RS06920 (1321415) | 1321415..1322254 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
| PUW21_RS06925 (1322307) | 1322307..1322576 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| PUW21_RS06930 (1322589) | 1322589..1322852 | + | 264 | WP_003232653.1 | phage holin | - |
| PUW21_RS06935 (1322865) | 1322865..1323758 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
| PUW21_RS06940 (1323795) | 1323795..1323932 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| PUW21_RS06945 (1324018) | 1324018..1324188 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| PUW21_RS06950 (1324188) | 1324188..1324934 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| PUW21_RS06955 (1325044) | 1325044..1326045 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| PUW21_RS06960 (1326058) | 1326058..1326675 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| PUW21_RS06965 (1326951) | 1326951..1328267 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
| PUW21_RS06970 (1328656) | 1328656..1329606 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
| PUW21_RS06975 (1329707) | 1329707..1329853 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1288435..1329853 | 41418 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T272926 WP_003244695.1 NZ_CP118167:c1324934-1324188 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|