Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 518264..518900 | Replicon | chromosome |
Accession | NZ_CP118167 | ||
Organism | Bacillus subtilis strain 21855 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PUW21_RS02640 | Protein ID | WP_003156187.1 |
Coordinates | 518550..518900 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | PUW21_RS02635 | Protein ID | WP_003225183.1 |
Coordinates | 518264..518545 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW21_RS02615 (514623) | 514623..515222 | - | 600 | WP_032722928.1 | rhomboid family intramembrane serine protease | - |
PUW21_RS02620 (515317) | 515317..515682 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
PUW21_RS02625 (515848) | 515848..516864 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
PUW21_RS02630 (516979) | 516979..518148 | + | 1170 | WP_015252766.1 | alanine racemase | - |
PUW21_RS02635 (518264) | 518264..518545 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PUW21_RS02640 (518550) | 518550..518900 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PUW21_RS02645 (519015) | 519015..519839 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
PUW21_RS02650 (519844) | 519844..520209 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
PUW21_RS02655 (520213) | 520213..520614 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
PUW21_RS02660 (520626) | 520626..521633 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
PUW21_RS02665 (521695) | 521695..522024 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
PUW21_RS02670 (522021) | 522021..522503 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
PUW21_RS02675 (522469) | 522469..523257 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
PUW21_RS02680 (523257) | 523257..523856 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T272925 WP_003156187.1 NZ_CP118167:518550-518900 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|