Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 2191222..2191872 | Replicon | chromosome |
| Accession | NZ_CP118165 | ||
| Organism | Glaesserella parasuis strain XP11 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7H8UVF2 |
| Locus tag | PUV55_RS11065 | Protein ID | WP_016527644.1 |
| Coordinates | 2191222..2191398 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A836YYB9 |
| Locus tag | PUV55_RS11070 | Protein ID | WP_016527643.1 |
| Coordinates | 2191456..2191872 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUV55_RS11045 (PUV55_11045) | 2186880..2187209 | - | 330 | WP_016527647.1 | phage tail protein | - |
| PUV55_RS11050 (PUV55_11050) | 2187214..2189664 | - | 2451 | WP_038513529.1 | phage tail length tape measure family protein | - |
| PUV55_RS11055 (PUV55_11055) | 2189890..2190348 | - | 459 | WP_016527646.1 | hypothetical protein | - |
| PUV55_RS11060 (PUV55_11060) | 2190453..2191124 | - | 672 | WP_160429042.1 | DUF6246 family protein | - |
| PUV55_RS11065 (PUV55_11065) | 2191222..2191398 | + | 177 | WP_016527644.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUV55_RS11070 (PUV55_11070) | 2191456..2191872 | + | 417 | WP_016527643.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUV55_RS11075 (PUV55_11075) | 2191918..2192397 | - | 480 | WP_016527642.1 | phage tail tube protein | - |
| PUV55_RS11080 (PUV55_11080) | 2192406..2192780 | - | 375 | WP_016527641.1 | hypothetical protein | - |
| PUV55_RS11085 (PUV55_11085) | 2192777..2193145 | - | 369 | WP_035490850.1 | hypothetical protein | - |
| PUV55_RS11090 (PUV55_11090) | 2193145..2193492 | - | 348 | WP_035490848.1 | hypothetical protein | - |
| PUV55_RS11095 (PUV55_11095) | 2193493..2193870 | - | 378 | WP_016527638.1 | hypothetical protein | - |
| PUV55_RS11100 (PUV55_11100) | 2193873..2194178 | - | 306 | WP_274358984.1 | hypothetical protein | - |
| PUV55_RS11105 (PUV55_11105) | 2194190..2195179 | - | 990 | WP_016527636.1 | encapsulin | - |
| PUV55_RS11110 (PUV55_11110) | 2195193..2195627 | - | 435 | WP_016527635.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2152059..2206754 | 54695 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6640.74 Da Isoelectric Point: 10.6914
>T272923 WP_016527644.1 NZ_CP118165:2191222-2191398 [Glaesserella parasuis]
VKQSEFLRWLKANGVEVENGTKHLKLYYNGKRSHLPKHPSQELKTGLVEGVKKQLGLK
VKQSEFLRWLKANGVEVENGTKHLKLYYNGKRSHLPKHPSQELKTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15470.82 Da Isoelectric Point: 4.5304
>AT272923 WP_016527643.1 NZ_CP118165:2191456-2191872 [Glaesserella parasuis]
MFYPALFTPAEEGGFVVTFPDIPEAITQGDTFEEAMEMAEDVLLSSVEIYFDDERAFPLSRPAGIYETSVFIPESVYAKI
LLHNTMCEKFISKAEVARLNNIKPPEIHRILAPRHTTRIDTIGRILASLGRPLQLSLA
MFYPALFTPAEEGGFVVTFPDIPEAITQGDTFEEAMEMAEDVLLSSVEIYFDDERAFPLSRPAGIYETSVFIPESVYAKI
LLHNTMCEKFISKAEVARLNNIKPPEIHRILAPRHTTRIDTIGRILASLGRPLQLSLA
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H8UVF2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A836YYB9 |