Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-stbD/ParE-DnaT |
| Location | 973655..974190 | Replicon | chromosome |
| Accession | NZ_CP118165 | ||
| Organism | Glaesserella parasuis strain XP11 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A836YZW4 |
| Locus tag | PUV55_RS04745 | Protein ID | WP_016528228.1 |
| Coordinates | 973655..973939 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A836Z1U9 |
| Locus tag | PUV55_RS04750 | Protein ID | WP_010785924.1 |
| Coordinates | 973936..974190 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUV55_RS04725 (PUV55_04725) | 969286..969777 | + | 492 | WP_160420853.1 | acetolactate synthase small subunit | - |
| PUV55_RS04730 (PUV55_04730) | 969884..970705 | - | 822 | WP_274360138.1 | PHP domain-containing protein | - |
| PUV55_RS04735 (PUV55_04735) | 970854..971813 | - | 960 | WP_016528226.1 | S-adenosyl-l-methionine hydroxide adenosyltransferase family protein | - |
| PUV55_RS04740 (PUV55_04740) | 971896..973446 | - | 1551 | WP_016528227.1 | exodeoxyribonuclease I | - |
| PUV55_RS04745 (PUV55_04745) | 973655..973939 | - | 285 | WP_016528228.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUV55_RS04750 (PUV55_04750) | 973936..974190 | - | 255 | WP_010785924.1 | plasmid stability protein StbD | Antitoxin |
| PUV55_RS04755 (PUV55_04755) | 974307..975062 | - | 756 | WP_010785925.1 | ABC transporter permease | - |
| PUV55_RS04760 (PUV55_04760) | 975084..975980 | - | 897 | WP_044009101.1 | ABC transporter ATP-binding protein | - |
| PUV55_RS04765 (PUV55_04765) | 975986..978004 | - | 2019 | WP_005712693.1 | DNA polymerase III subunit gamma/tau | - |
| PUV55_RS04770 (PUV55_04770) | 978092..978634 | - | 543 | WP_005712695.1 | adenine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11276.27 Da Isoelectric Point: 10.5362
>T272919 WP_016528228.1 NZ_CP118165:c973939-973655 [Glaesserella parasuis]
MSYTIEFIPSAEKEFRKLSLDLRKQFIEKLKERAENPRVESAKLRGMKDCYKIKLRNAGYRLVYQVIDERIVIKVVAQGK
RERNDVYQKVQLRL
MSYTIEFIPSAEKEFRKLSLDLRKQFIEKLKERAENPRVESAKLRGMKDCYKIKLRNAGYRLVYQVIDERIVIKVVAQGK
RERNDVYQKVQLRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A836YZW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A836Z1U9 |