Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 273938..274715 | Replicon | chromosome |
| Accession | NZ_CP118165 | ||
| Organism | Glaesserella parasuis strain XP11 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | B8F4U7 |
| Locus tag | PUV55_RS01370 | Protein ID | WP_005710654.1 |
| Coordinates | 273938..274438 (-) | Length | 167 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | U4SPD7 |
| Locus tag | PUV55_RS01375 | Protein ID | WP_005710653.1 |
| Coordinates | 274428..274715 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUV55_RS01335 (PUV55_01335) | 269063..269218 | - | 156 | WP_005710668.1 | YoaH family protein | - |
| PUV55_RS01340 (PUV55_01340) | 269236..269964 | - | 729 | WP_021115014.1 | tRNA pseudouridine(65) synthase TruC | - |
| PUV55_RS01345 (PUV55_01345) | 269961..270275 | - | 315 | WP_005710664.1 | YqcC family protein | - |
| PUV55_RS01350 (PUV55_01350) | 270317..271231 | - | 915 | WP_082259327.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| PUV55_RS01355 (PUV55_01355) | 271243..272358 | - | 1116 | WP_035519838.1 | anhydro-N-acetylmuramic acid kinase | - |
| PUV55_RS01360 (PUV55_01360) | 272513..272848 | - | 336 | WP_005710658.1 | outer membrane protein assembly factor BamE | - |
| PUV55_RS01365 (PUV55_01365) | 272909..273910 | - | 1002 | WP_005710656.1 | nucleoid-associated protein YejK | - |
| PUV55_RS01370 (PUV55_01370) | 273938..274438 | - | 501 | WP_005710654.1 | GNAT family N-acetyltransferase | Toxin |
| PUV55_RS01375 (PUV55_01375) | 274428..274715 | - | 288 | WP_005710653.1 | DUF1778 domain-containing protein | Antitoxin |
| PUV55_RS01380 (PUV55_01380) | 274861..275250 | + | 390 | WP_035519839.1 | RidA family protein | - |
| PUV55_RS01385 (PUV55_01385) | 275254..275991 | + | 738 | WP_274359847.1 | peptidoglycan editing factor PgeF | - |
| PUV55_RS01390 (PUV55_01390) | 276166..277743 | + | 1578 | WP_010786634.1 | FAD-binding protein | - |
| PUV55_RS01395 (PUV55_01395) | 277849..278349 | + | 501 | WP_010786633.1 | CvpA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 19184.39 Da Isoelectric Point: 9.3198
>T272916 WP_005710654.1 NZ_CP118165:c274438-273938 [Glaesserella parasuis]
MKSKFIEEPLTKHHQREAFDCGNLEMNRFFKQYARQSHEKGTSKTYISRHLDSQQIIGFYTITLSALDQQHLPELCKKRF
GYHPIPLFTLARLAVDIRYQKQGIGGMLLVKALKRCAIVAEQVWGIGLLIEAKDEDISRWYQSYGAIPLENMPLTLILLF
DTIKGL
MKSKFIEEPLTKHHQREAFDCGNLEMNRFFKQYARQSHEKGTSKTYISRHLDSQQIIGFYTITLSALDQQHLPELCKKRF
GYHPIPLFTLARLAVDIRYQKQGIGGMLLVKALKRCAIVAEQVWGIGLLIEAKDEDISRWYQSYGAIPLENMPLTLILLF
DTIKGL
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A836YZP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U4SPD7 |